=========================================================================
date: fri, 15 oct 1999 10:05:10 +1000
reply-to: sherlyn koo <sherlyn@fl.net.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sherlyn koo <sherlyn@fl.net.au>
subject: re: review in ny post
in-reply-to: <199910132342.taa21968@smoe.org>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
sheryl forwarded an article which said:
>in the mid-show tune "cold beer and remote control," for example, a tale of
>a shattered american dream is tempered with the notion that cold beer and
>the clicker can soothe a woman's soul - just like it can a man's.
funny, i figured that the narrator of this song was a guy...
not that it matters either way i guess...
-sherlyn
=-= sherlyn koo - sherlyn@fl.net.au =-=-=-=-=-=-= [sydney, australia]
"raise your hands, raise your hands high,
don't take a seat, don't stand aside this time,
don't assume anything, just go go go" - indigo girls
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 17:19:19 pdt
reply-to: karen murphy <murphyslaw77@netscape.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: karen murphy <murphyslaw77@netscape.net>
subject: re: [re: [re: nyc last night]]
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 8bit
karen murphy <murphyslaw77@netscape.net> wrote:
iudoremi@aol.com wrote:
i have a boot of them doing it last year somewhere. if i find it, i'll let
you know. i think it's pretty good but i don't remember. let me know if you
want it and i'll look for it,
carrie
no, it was december of 97 so that's almost 2 years ago. it was still good
though, i think.
thank you so much for responding! but you're off the hook =0)
someone said they'd be posting info about the nyc boot to the list... thanks
though!
-k
duh!!!!! i didn't mean to post this to the whole list! oh well.....
____________________________________________________________________
get your own free, personal netscape webmail account today at http://webmail.netscape.com.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 19:22:56 -0500
reply-to: barbara bordner <barbinmn@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: barbara bordner <barbinmn@webtv.net>
subject: re: mumia...
in-reply-to: neil <neily@netreach.net>'s message of thu, 14 oct 1999 19:02:03
-0400
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
his gilt was never established, his first lawyer
was drunk at times, mumia himself was shot,
he had been an outspoken activist, and journalist, with a history of
coming down on
the philadelphia police for their brutality, and
that gives them plenty of reason to want him right there.
mumia asked if he could be allowed to defend himself, afterall that is
everyone's right, but the court said, "no," mumia may have been
convicted, but the jury system inthis country has
always been biased in favor of whites, you can see that when you take a
look at the fact that most on death row are black.
furthermore, new evidence came out in the last two years that cast
enough reasonable doubt
on his conviction, and death sentence, two witnesses came forward and
said that they were coerced by the philadelphia police to say
that he shot faulkner, but that evidence was thrown out because the
jdge who first sentenced mumia, is the same man who denied mumia a
new trial, (and no, i'm not black, and yes judge sabo is in a higher
position now, and that's why he ended-up with mmia's case again.)
at any rate mumia is now on death watch, he has no contacts with anyone
but his lawyer,
he was stripped of his own clothes and made
to where death watch clothes, has no communication at all, and so it's
up to us all
to speak for him now. i'm sure the girls would.
one last question: if we want a person on death row to die, why do
authorities seem so concerned for an inmates " safety" when they are
outside in a wire cage, (that's how inmates
get their sunshine on death row) on a stormy day? prisoners were
hurdled back inside, the
guards said it was for safety? one inmate retorted,"why? so we won't get
electrocuted?"
(and i don't want any flames.)
peace;
barb
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 20:30:40 edt
reply-to: poohbea487@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: poohbea487@aol.com
subject: jersey show
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
can someone e-mail me privately about directions to the show? also, is anyone driving from/through manhattan who could help me with something? any help would be greatly appreciated. thanks.
-laura
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 17:39:49 -0700
reply-to: graham ames <mcgee@oregontrail.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: graham ames <mcgee@oregontrail.net>
subject: re: ig/macbeth connection
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
la8rga8r@aol.com wrote:
>
> ok, we're reading macbeth in my senior english class and for those literary
> buffs out there/and those who aren't, macbeth's most famous lines in the play
> are:
*snip*
> any of that sound familiar?? the first time i read it something clicked in
> my head that part of it was in an ig song and i started to have lyrics
> running through my head but couldn't connect it b/c i had to keep up in
> class. but today i re-read it and it clicked!!! i'm sure the expression on
> my face was priceless......but check this out:
*quote from "virginia woolfe" cut*
but aren't those lines at the beginning of vw actually a quote from vw
herself? surely there's more than one level of reference going on
here...
--
graham ames
mcgee@oregontrail.net
http://www.oregontrail.net/~mcgee/
icq: 3857882 aol-im: hipebear
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 20:50:02 -0400
reply-to: brenda krebs <bkrebs@prodigy.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: brenda krebs <bkrebs@prodigy.net>
subject: nigc-melissa ticket
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
hi y'all!!
i have an extra ticket for the melissa etheridge show at the tower
theatre oct.23. i am asking face value which is $76.00. the seat is
left/center orchestra, row m seat 116. please e-mail if you are
interested. thanks.
brenda
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 19:53:23 -0500
reply-to: barbara bordner <barbinmn@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: barbara bordner <barbinmn@webtv.net>
subject: re: audience confrontation/song requests
in-reply-to: jean moses <sneakyjean@yahoo.com>'s message of thu, 14 oct 1999
15:13:16 -0700
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
.jean writes that she doesn't think we need to hear all this....well,
jean if you feel that way,
fine, but please speak for yourself. i think it's
interesting to hear everyones ideas on it.
peace,
barb
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 21:01:11 -0400
reply-to: debbie woodell <woodeld@phillynews.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: debbie woodell <woodeld@phillynews.com>
subject: re: audience confrontation/song requests
hey, all,
on the subject of calling out song titles, i'm generally happy with whatever anyone decides to play. it's their show.
deb
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 21:00:14 -0400
reply-to: ruth israely <gammage@brandeis.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: ruth israely <gammage@brandeis.edu>
organization: brandeis university
subject: nigc- [fwd: france passes partnership]
mime-version: 1.0
content-type: multipart/mixed; boundary="------------c4e82f78b61a9ab9b2e8f1c0"
this is a multi-part message in mime format.
--------------c4e82f78b61a9ab9b2e8f1c0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
hi everyone!!!
france passed a domestic partnership bill!!
check it out!!
ruth
--------------c4e82f78b61a9ab9b2e8f1c0
content-type: message/rfc822
content-transfer-encoding: 7bit
content-disposition: inline
return-path: <web@hiss.pno.net>
received: from clavin2.unet.brandeis.edu (clavin2.unet.brandeis.edu [129.64.99.33])
by carla.unet.brandeis.edu (8.9.3/8.9.3) with esmtp id raa19416
for <gammage@gopostal.undergrad.brandeis.edu>; thu, 14 oct 1999 17:09:25 -0400
received: from slam.internal.pno.net (slam.internal.pno.net [207.82.90.20])
by clavin2.unet.brandeis.edu (8.9.3/8.9.3/unet1.5) with esmtp id raa20419
for <gammage@brandeis.edu>; thu, 14 oct 1999 17:09:20 -0400
received: from hiss.pno.net (hiss.pno.net [207.82.13.52])
by slam.internal.pno.net (8.9.3/8.9.3) with esmtp id oaa12876
for <gammage@brandeis.edu>; thu, 14 oct 1999 14:08:21 -0700 (pdt)
received: (from web@localhost)
by hiss.pno.net (8.9.3/8.9.3) id oaa28209
for gammage@brandeis.edu; thu, 14 oct 1999 14:08:52 -0700 (pdt)
date: thu, 14 oct 1999 14:08:52 -0700 (pdt)
message-id: <199910142108.oaa28209@hiss.pno.net>
from: "ruth israely" <gammage@brandeis.edu>
to: gammage@brandeis.edu
subject: france passes partnership
this planetout news article has been sent to you by ruth israely
(gammage@brandeis.edu):
________________________________________________________________
france passes partnership
by newsplanet staff
wednesday, october 13, 1999 / 11:00 am
http://www.planetout.com/news/article.html?1999/10/13/1
summary:
the hard-won pacts of civil solidarity will give same-gender couples and unmarried heterosexuals most marriage rights, but the defeated conservatives will still try to silence any wedding bells.
________________________________________________________________
you can find more planetout news at http://www.planetout.com/news/.
to get planetout news headlines sent to you every day, visit
http://www.planetout.com/pnodirect/.
--------------c4e82f78b61a9ab9b2e8f1c0--
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 21:14:28 edt
reply-to: vickistein@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: vicki stein <vickistein@aol.com>
subject: re: ig/macbeth connection
x-to: la8rga8r@aol.com
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
excellent observation!
okay, hi, i'm vicki, new to the list (but not to the internet or the indigo
girls), brit lit major, shakespeare concentration, class of '82 at nmu
(northern michigan university).
my biggest fear, at the very moment, is that i loaned my "rites of passage"
cd to someone who may not appreciate it as much as i do. actually, what i'm
really missing is my ""rites of passage" cd cloaked in the "nomads, indians,
and saints" case. looks like a bit of searchin' or even redux is in order.
i love the indigo girls. they are at the top of the list of all time for
artists who move me. ig are there with the beatles, buddy holly & the
crickets, pete seeger, james taylor, bob dylan, joan baez, joni mitchell, csn
(&y), the eagles, nanci griffith, peter gabriel, bruce cockburn, rem, talking
heads, ani difranco, early fogelberg, lou reed, and my hero, elvis costello.
(in no certain order, and there are many more artists i just absolutely
admire). in fact, since 1989, the indigos remain on my most frequently
played list along with elvis costello and vince gill christmas (it brings out
the saint in me)....i chase songwriters....
be that as it may, and no one really cares, i am sure, i am the divorced
mother of a very cool 11 year old daughter. i like men, though they elude
me...always have and always will. not to stereotype...the many men are all i
have known. sarcasm intended. i look forward to being a member of the
list. i have many comments, as you will see, about many ig songs...i just
simply want to peruse the list for a bit and follow the feeelings.
i have experienced the indigo girls in concert once...at jack breslin center
(msu) in 1993, sitting in the 8th row with my boyfriend at the time...the
concert is my favorite of all, i think (i still remember the set list and all
of the tears that just came forth). i had tickets to see them at calvin
college in 97, i think it was, but my brother, who lived with me then,
smashed his leg in a car wreck that night, so priorities superseded.
now, i have tickets to see em and amy at the wiltern theatre in la on 11/05,
and i am completely and totally and every other umpteenth adverb geeked about
this. my housecleaning partners, my heartcleaning partners....live in los
angeles!
shucks, i am 39 years old...if there is any way i could let them know how
much of an influence they've had on my life. my marriage ended when i
kissed another man to "kid fears" and "love's recovery..."
but i go on, so, forgive me for the confessional.
peace.
vicki "courting some disaster" stein
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 20:28:20 -0500
reply-to: barbara bordner <barbinmn@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: barbara bordner <barbinmn@webtv.net>
subject: ig tv don't forget.......
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
to watch the girls tomorrow on the view,
10 a.m. cdt. :-)
peace,
barb
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 18:53:18 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: re: audience confrontation/song requests
mime-version: 1.0
content-type: text/plain; charset=us-ascii
whoops!
hey all, i didn't mean to stop expressing your opinions... i only meant
that i didn't feel like anyone on this list was the type that would be
so rude... and isn't it sad that we're not reaching the people that
should hear it.
sorry, i've been home sick and i'm hopped-up on anti-biotics... prolly
shouldn't post when i'm groggy and not feeling well, i don't express
myself very well.
apologies all around... and keep on talkin'!
jean
--- barbara bordner <barbinmn@webtv.net> wrote:
> .jean writes that she doesn't think we need to hear all
> this....well,
> jean if you feel that way,
> fine, but please speak for yourself. i think it's
> interesting to hear everyones ideas on it.
>
> peace,
>
> barb
>
> --
> all listserv commands should be sent to listserv@netspace.org.
> to unsubscribe issue the command: signoff indigo-girls
> for help write to indigo-girls-request@netspace.org.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 22:16:43 -0400
reply-to: anna creech <creechal@jmu.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: anna creech <creechal@jmu.edu>
organization: james madison university
subject: audience expressions of freaky fandom
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
at the patriot center show, someone screamed "we love you" in the middle of a
lull between songs. my friend sitting next to me says in an exasperated tone,
"of course we love them or we wouldn't have paid $40 a ticket to be here!"
that was about the only thing she said in a complete sentence throughout the
entire show, though. the rest of the time she was babbling about her new
infatuation with kaia from the butchies. made me thing of a certain listee with
the initials sbm.
:)
anna
--
http://raven.jmu.edu/~creechal/index.htm ~ np: cate friesen
i wore hot pink shorts on the tennis court the other day and i felt like a free
woman. -rose polenzani
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 19:48:22 -0700
reply-to: mocagu <mocagu@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: mocagu <mocagu@yahoo.com>
subject: reminder. ig on tnt latinamerica
mime-version: 1.0
content-type: text/plain; charset=us-ascii
for all the ig latin fans tomorrow tnt will be airing
their hard rock special.
october 15/10/99 22:00 (bas)/21:00 (mex)
take care,
mocagu
=====
"the most wasted day of all is that in which we have not laughed"
sébastien-roch nicolas de chamfort
"what we call human nature in actuality is human habit"
jewel
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 23:11:20 edt
reply-to: gitroop@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "<erin tripp>" <gitroop@aol.com>
subject: jonas & ezekiel/conspiracy theory
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
-this might be a random coincidence, but i was watching the movie conspiracy
theory this past weekend and noticed that 3/4 the way thru the movie, two
main characters pop up, named jonas and ezekiel... they had close relations
in the movie plot... now, i found this quite odd, since i've never even heard
the name jonas before.. no, not in the bible either. anyone know what year
this movie came out? does it have any relevence to amy's song?
-just a thought...
g'nite-
trooper
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 23:28:51 edt
reply-to: flg940bigr@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: flg940bigr@aol.com
subject: cons and clare
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i've got a tape of cons in the car, and today was the first time clare had a
chance to hear it, and well, she was captive in the car. anyway, out of the
corner of my eye i caught her "air drumming" to go, and she got mellow for
peace tonight... and i sang gone again at her with no perceptible reaction...
but after trouble, she just declared (as only clare can de-clare) "this is a
strange, strange record...it's got ten different styles...." shaking her
head. i just laughed. we understand how ig refuses to be nailed down to a
genre, one of the wonderful things about them. cons isn't as singable as the
other ones, or it just maybe that i haven't really learned the songs.. but as
so many of us have said, a lot of their songs have to grow on us. i'm
definitely loving go and gone again, developing an affection to trouble and
peace tonight... the jury is still out on the rest of them.
freida
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 14 oct 1999 22:06:38 -0600
reply-to: melissa genevieve young <mgy@burgoyne.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: melissa genevieve young <mgy@burgoyne.com>
subject: jonas & ezekiel/conspiracy theory
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
the movie came out in 1997. i would say that the chances the two are
related are quite slim. however, if you want to look into it, the
screenwriter's name is brian helgeland and he also wrote la confidential and
payback (well, mostly). however, i have to thank you for making a
connection (however minute) between my two favorite things, mel gibson and
indigo girls :o)
melissa.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 00:22:29 edt
reply-to: peachy706@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: peachy706@aol.com
subject: help- igc- the view :).
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
help help! when does it come on and what channel? anyone? please please by
7:30 a.m. tomorrow ;) i'm in athens, ga if that makes a difference.....
thanks thanks!
katie ;)
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 07:58:23 edt
reply-to: wishmonstr@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "e. moranian bolles" <wishmonstr@aol.com>
subject: (nigc) falwell confidential
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
thought this was interesting, to say the least.
~ elizabeth
jerry falwell writes:
<< media appearances: on monday, october 8, i will be appearing on
msnbc's internight, with host john gibson (7:00-8:00 p.m., et). i
will be discussing the summit i am hosting next week (october 23,
24) in which i am calling for all christian ministries to halt any
rhetoric that might engender violence against the homosexual
community, and vice versa. as i have reported, i remain committed
to preaching that homosexuality is sin, as described in the bible.
however, i feel compelled to lead this charge of anti-violence from
the conservative christian perspective. we will never reach
homosexuals with the gospel of jesus christ if we preach from a
malicious standpoint. i believe that god hates the sin of every man
... yet he invites us all - equally - through his divine grace, so
that we may become "new creatures" in him. please pray for me as i
host this meeting that will have many homosexual leaders present. >>
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 09:53:03 -0400
reply-to: sarah pinsker <spinsker@goucher.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sarah pinsker <spinsker@goucher.edu>
subject: ngltf press release on ig
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 8bit
*********************************************
national gay and lesbian task force
press release
contact:
david elliot, communications director
202-332-6483 ext. 3303
800-757-6476 pager
delliot@ngltf.org
http://www.ngltf.org
1700 kalorama road nw, washington, dc
*********************************************
music for the movement: indigo girls'
latest tour and cd feature ngltf
oct. 14, 1999 the indigo girls, long-time supporters of human
rights and equality for gay, lesbian, bisexual and transgender
people, have listed the national gay and lesbian task force as
a resource on the cover of their latest cd, "come on now social",
and are distributing ngltf literature during their current tour,
which is taking them to at least 16 locales in 12 states
through october.
the cd, which was released on tuesday, sept. 28, lists ngltf
along with several other human rights organizations: women's action
for new directions, the honor the earth campaign, youth pride,
coalition of environmental federations, z magazine, ms. magazine,
national coalition to abolish the death penalty, and handgun
control, inc. the indigo girls also began distributing ngltf
literature with their sept. 30 concert gig in knoxville, tenn.
the indigo girls and ngltf have a history of supporting each
other's work. in august 1998, the indigo girls joined in the
celebration of the task force's 25th anniversary, donating the
proceeds from a sold-out washington, d.c. performance. shortly
after that, then-ngltf communications director tracey conaty,
joined the indigo girls during the "spitfire tour," which
featured musicians, actors and activists speaking out on
global human rights concerns. and in october 1998, amy ray
of the indigo girls issued a press release through the task
force deploring the killing of matthew shepard.
"i want people to remember that gay people are still hated
because they are gay," said the indigo girls' emily saliers.
"we have come a long way, but we have such a long, long way
to go yet."
ngltf executive director kerry lobel thanked the indigo girls
for their work on behalf of human rights. "the indigo girls'
music lifts us up spiritually, but even more important, the
indigo girls' activism and leadership on behalf of marginalized
and oppressed people offers us a role model as we go into our
communities and do the heavy lifting that is required to move
progressive causes forward," lobel said.
_____________________________________________________________________
founded in 1973, the national gay and lesbian task force works to eliminate
prejudice, violence and injustice against gay, lesbian, bisexual and
transgendered people at the local, state and national level. as part of a
broader social justice movement for freedom, justice and equality, ngltf is
creating a world that respects and celebrates the diversity of human
expression and identity where all people may fully participate in society.
_________________________________________________________________
the national gay and lesbian task force presents the creating change
conference - the nation's premier conference for activists and organizers in
the gay, lesbian, bisexual, and transgender movement.
november 10-14 * oakland, ca * http://www.creatingchange.org
_________________________________________
this message was issued by the national gay and lesbian task force. if you
have a question regarding this post, please direct it to the contact at the
top of this message.
if you wish to unsubscribe from this list, please send an email with
"unsubscribe activist" in the subject and body of your email message to
<listserv@list.ngltf.org>. you may also unsubscribe by visiting
http://www.ngltf.org.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 06:57:52 -0700
reply-to: melissa gordon <melissa@ce1.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: melissa gordon <melissa@ce1.com>
organization: creative endeavors
subject: re: (nigc) falwell confidential
x-to: wishmonstr@aol.com
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
now, what would mr. fallwell say to that reverend who has picketed matthew
shepard's trial, funeral etc (wildmon, i think his name)?
melissa
>
> jerry falwell writes:
>
> << media appearances: on monday, october 8, i will be appearing on
> msnbc's internight, with host john gibson (7:00-8:00 p.m., et). i
> will be discussing the summit i am hosting next week (october 23,
> 24) in which i am calling for all christian ministries to halt any
> rhetoric that might engender violence against the homosexual
> community, and vice versa. as i have reported, i remain committed
> to preaching that homosexuality is sin, as described in the bible.
> however, i feel compelled to lead this charge of anti-violence from
> the conservative christian perspective. we will never reach
> homosexuals with the gospel of jesus christ if we preach from a
> malicious standpoint. i believe that god hates the sin of every man
> ... yet he invites us all - equally - through his divine grace, so
> that we may become "new creatures" in him. please pray for me as i
> host this meeting that will have many homosexual leaders present. >>
>
> --
> all listserv commands should be sent to listserv@netspace.org.
> to unsubscribe issue the command: signoff indigo-girls
> for help write to indigo-girls-request@netspace.org.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 07:41:36 -0700
reply-to: beccie lyon <dovesland@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: beccie lyon <dovesland@yahoo.com>
subject: nigc: pa governor signs mumia abu-jamal death warrant
mime-version: 1.0
content-type: text/plain; charset=us-ascii
here is some information that i was given on the mumia
case. thought you guys would be interested in
it...does anyone else have any other information on
this? if so please email me...thanks...
> from: c. clark kissinger [mailto:cck1@earthlink.net]
> sent: wednesday, october 13, 1999 5:20 pm
> to: cck1@earthlink.net
> subject: pa governor signs mumia abu-jamal death
> warrant
>
>
> pa governor signs mumia abu jamal's death warrant
> despite expected habeus
> corpus petition citing new evidence of innocence,
> prosecutorial misconduct,
> racial bias
>
> abu jamal's legal team to file habeus corpus
> petition friday, october 15 at
> 10:00 a.m. at the federal district court in
> philadelphia, pa
>
> press conference will follow at 11:00 a.m. at the
> american friends services
> committee, 15th and cherry street
>
> rush to execute violates defendant's basic legal
> rights and opposes
> philadelphia and pennsylvania bar associations'
> recent call for a moratorium
> on executions
>
> philadelphia, oct. 13 /prnewswire/ -- governor ridge
> of pennsylvania today
> signed the death warrant of mumia abu jamal, despite
> an expected habeus
> corpus petition from the defendant's lawyers citing:
> fabrication and
> suppression of evidence; racial bias in selecting
> jurors; and denial of the
> right to self- representation, among other
> arguments.
>
> this is the 171st death warrant governor ridge has
> signed since 1994 -- five
> times the number signed by his predecessors over a
> 25-year period.
> ninety-nine percent of those warrants signed by
> ridge were done while the
> inmates still had time to appeal.
>
> aside from not waiting for the habeus corpus
> petition -- a process that all
> defendants are legally entitled to -- governor ridge
> also decided to sign
> jamal's warrant despite the philadelphia and
> pennsylvania bar associations'
> recent call for a moratorium on all executions until
> the death penalty
> system is proven just.
>
> one of the system's infirmities, acknowledged by the
> bar associations, has
> to do with racial prejudice. while nine percent of
> pennsylvania's total
> population is african-american, for example, the
> percentage on death row is
> nearly seven times that amount (62%). this is the
> largest racial disparity
> of any state in the united states.
>
> in addition, a 1998 study by professor baldus at the
> university of iowa
> found that a young african-american man growing up
> in philadelphia is 11.5
> times more likely to end up on death row than in
> georgia or alabama.
>
> ''ridge is rushing to execute before all the
> evidence has been presented,''
> said leonard weinglass, jamal's lead attorney.
> ''since when does one man's
> political motivations override another's right to a
> fair trial, especially
> when a human life is in question?''
>
> since the death penalty was reinstated in 1976, 81
> people have been
> exonerated. rushing executions assures that people
> who are on death row as a
> result of errors in process or issues of actual
> innocence will not be saved
> through the appellate process.
>
> the habeus corpus petition, which governor ridge
> knew was being filed for
> federal review, contains more than 29 separate
> issues of constitutional
> violations that occurred in jamal's trial and
> appeal. it is more than 150
> pages, and contains more than 600 paragraphs of
> factual allegations
> pertinent to the case.
>
> ''several arguments will be raised in the petition
> demonstrating that jamal
> never received a meaningful trial and that
> compelling evidence of innocence
> was ignored by the state courts of pennsylvania,''
> said daniel williams, co-
> counsel.
>
> ''above and beyond the issue of innocence -- which
> is paramount in this
> case -- are the transcendent issues of whether or
> not in the 1990's someone
> ought to be executed when the trial attorney admits
> he interviewed no
> witnesses and conducted no investigation; when 11
> african-american jurors
> were removed on the basis of race; and when the
> prosecution wrongly used a
> teenager's political statements to give the death
> penalty to an adult 12
> years later,'' said weinglass.
>
> in addition to the defending attorneys, those
> working to ensure a fair trial
> for jamal include: amnesty international, archbishop
> desmond tutu, the
> european parliament, reverend jesse jackson and many
> others.
>
> source: leonard weinglass, esq.
>
>
>
=====
peace, love & indigo light
beccie lyon
may the path that you are on take you above
your expectations for the road ahead
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 15:52:35 +0100
reply-to: marion_o'sullivan@health.irlgov.ie
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: marion_o'sullivan@health.irlgov.ie
subject: ig making plans for new suffragette tour
mime-version: 1.0
content-type: text/plain; charset=us-ascii
indigo girls making plans for return of the suffragette tour
http://www.launch.com/features/fs_start/?contentid=4211&contenttype=news&vo
=mnwn
(10/15/99, 7 a.m. pdt) - the indigo girls took an
eclectic collection of
female artists out on the road last year for a short
trek dubbed the suffragette
sessions tour. the girls, emily saliers and amy ray,
tell launch that
they enjoyed the tour so much the first time out that
they're going to put
together a second run for fall 2000.
"we're already talking about making plans for that,"
sailers said. "it will
probably happen at the end of, or in, the fall--next
fall, at the end of our
touring season. we'll wrap it up with something really,
really fun. we totally
dug that tour last time."
added ray, "i mean, the suffragettes were, like, just
kind of like the best of
every world for us. we played clubs, which we loved
doing. we took 12
women...crammed onto a bus, of all different walks of
life and music, and we
all tried to get along and learn each other's
music...it was intense. i keep
dreaming about it--having weird dreams about
suffragettes sessions tour, i
don't know why. so maybe it's a good sign."
the indigo girls' latest album, come on now social, is
now in stores. the
duo is on tour, playing asbury park, n.j. tonight. ray
and saliers will also
pop up on abc's the view today. check your local
listings.
the first suffragette sessions tour featured the indigo
girls, gail ann
dorsey, lisa germano, lourdes perez, luscious jackson's
kate
schellenbach, jane siberry, mecca normal's jean smith,
heart's ann
wilson, former breeders member josephine wiggs, come's
thalia
zedek, and japanese acts shonen knife and buffalo
daughter.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 11:44:59 edt
reply-to: indigo3000@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: indigo3000@aol.com
subject: the view...
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
wow...amy and the black tank top are back. tattoo showing and all. hmm..
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 08:54:55 pdt
reply-to: karen murphy <murphyslaw77@netscape.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: karen murphy <murphyslaw77@netscape.net>
subject: re: [the view...]
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 8bit
indigo3000@aol.com wrote:
wow...amy and the black tank top are back. tattoo showing and all. hmm..
i am going to f*ing cry!!!!!! the f*ing view is on channel f*ing 2, which is
baltimore wmar/abc.... and i am in f*ing dc where we dont get wmar and abc is
channel f*ing 7, and it's the f*ing martin short show..... on which they're
discussing creme fucking broulee!!!!!!!!!! (which i cant even spell!) and
carmelized fucking sugar!
dammit dammit dammit dammit dammit dammit dammit dammit dammit dammit
-k
____________________________________________________________________
get your own free, personal netscape webmail account today at http://webmail.netscape.com.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 11:59:42 -0400
reply-to: sarah brady <sbrady1@email.unc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sarah brady <sbrady1@email.unc.edu>
subject: the view
mime-version: 1.0
content-type: text/plain; charset=us-ascii
i think its absolutely amazing that a&e can continue to be gracious and to
smile when being asked for the 5 millionth time if they are sleeping
together. why dont interviewers do any research whatsoever before asking
silly questions?! *argh*
-sarah
_______________________________________________________________________________
a&e "i will walk down the street. i will hold my head high. i will say
# hello to everyone i meet. i will have love in my heart. when i
# have hate, i will turn my hate into energy. and when i have anger,
_#_ i will turn my anger into energy. when i am negative, i will be
( # ) negative only for as long as i need to be, until i understand it
/ o \ and then i will be positive. and i will not be complacent. and i
( === ) will not be complacent. and i will not be a racist. and i will not
'---' a sexist. and i will not be a homophobic asshole. and i will love.
and i will love. and i will be happy that i am alive." -amy ray
______________________________________________________________________________
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 08:59:27 -0700
reply-to: melissa gordon <melissa@ce1.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: melissa gordon <melissa@ce1.com>
organization: creative endeavors
subject: re: [the view...]
x-to: karen murphy <murphyslaw77@netscape.net>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
ok, here's my "view":
imagine a black tv screen.....las vegas doesn't "carry" the view.
i'm not crying or getting upset, i called up both my father & step-dad (in
la) so that they'll video tape the show. why both you might ask?
easy....between the two of them, i hope to get one viewable tape.
praying that my dads do not subscribe to this list....
melissa
----- original message -----
from: karen murphy <murphyslaw77@netscape.net>
to: <indigo-girls@netspace.org>
sent: friday, october 15, 1999 8:54 am
subject: re: [the view...]
> indigo3000@aol.com wrote:
> wow...amy and the black tank top are back. tattoo showing and all. hmm..
>
> i am going to f*ing cry!!!!!! the f*ing view is on channel f*ing 2, which
is
> baltimore wmar/abc.... and i am in f*ing dc where we dont get wmar and abc
is
> channel f*ing 7, and it's the f*ing martin short show..... on which
they're
> discussing creme fucking broulee!!!!!!!!!! (which i cant even spell!) and
> carmelized fucking sugar!
> dammit dammit dammit dammit dammit dammit dammit dammit dammit dammit
> -k
>
> ____________________________________________________________________
> get your own free, personal netscape webmail account today at
http://webmail.netscape.com.
>
> --
> all listserv commands should be sent to listserv@netspace.org.
> to unsubscribe issue the command: signoff indigo-girls
> for help write to indigo-girls-request@netspace.org.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 12:14:48 -0400
reply-to: kelly fairbairn <fairbk@sage.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kelly fairbairn <fairbk@sage.edu>
subject: re: the view
in-reply-to: <pine.a41.3.95l.991015115823.412952x-100000@login5.isis.unc.edu>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
on fri, 15 oct 1999, sarah brady wrote:
> i think its absolutely amazing that a&e can continue to be gracious and to
> smile when being asked for the 5 millionth time if they are sleeping
> together. why dont interviewers do any research whatsoever before asking
> silly questions?! *argh*
> -sarah
silly me forgot to set the vcr this morning in my tylenol sinus-induced
haze. who taped it and can i beg a copy? i'll make it worth your
while...<wink,wink>
kelly
np (in my head): highway five by paddy kilrain
nc: patty larkin tonight and ellis paul tomorrow night. i love the fall
concert season. :)))
%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%
%^ kelly fairbairn %^
^% ill dept. ^%
%^ sage troy campus library %^
^% fairbk@sage.edu ^%
%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 09:35:54 -0700
reply-to: joan morrison <morrison_joan@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: joan morrison <morrison_joan@yahoo.com>
subject: re: (nigc) falwell confidential
mime-version: 1.0
content-type: text/plain; charset=us-ascii
i am calling for all christian
> ministries to halt any
> rhetoric that might engender violence against the
> homosexual
> community, and vice versa.
...and vice versa????? excuse me??? i don't think
this is a problem!
his attitude is still annoying, but at least it is a
start... i wonder if this conference was born out of
his recent meeting with mel white (i think) and a
group of gay people?
peace!
=====
joan :-d
visit my home page:
http://www.hometown.aol.com/joanm12345/index.html
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 09:38:07 -0700
reply-to: hawke2@email.msn.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: ryan blackhawke <hawke2@email.msn.com>
subject: re: audience confrontation (grrrr)
in-reply-to: <19991014220424.20596.rocketmail@web1005.mail.yahoo.com>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
> -----original message-----
> first of all the people shouting aren't nessecarily
> evil audience members, it may be their first indigo
> girls concert or whatever and they are just excited
> and riled up from seeing the girls playing live and
> perhaps anxious that they wont get to hear their
> favorite song.
i consider them more as self-absorbed twits who care nothing about their
fellow concert-goers. they are not getting a command performance, therefore
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
they should act like guests. the girls don't have to tour and put up with
such selfishness but they do because they know 99.9% of their audience are
mature and can enjoy such an "emotional experience" with respect to them and
their fellow concert-goers. there is nothing like spending $70 for a pair of
tickets to see your all-time favorite performers and having the concert
all-but-ruined by some drunken, overzealous idiots who don't know when to
shut up. (which was a big problem with the bumbershoot boot)
> a concert is supposed to be an
> emotional event and good manners and logic sometimes
> get forgotten in the context of high emotion.
so if you have no impulse control (you meaning the generalized you, not you
personally), use the money for some therapy to teach you some instead of
ruining the show for everyone.
> given
> that, i do agree that the behavior was annoying and
> amy's reaction was certainly undestandable and even
> justified.
i'd consider it more like a parent who is just fed up. they let it slide so
long until it is quite obvious their displeasure needs to be let known to
the child so said "child" can check their behavior.
> however, that's all it was, a reaction. in tuesday
> nights show for example, she made her speil when there
> was only one song left anyway and a loud one to boot
> so its not like it made any difference. and you've got
> to admit having a really quiet song during the encore
> was just asking for it!
why? because some people don't know how to act, therefore the girls are
getting what they deserve?
>
> since it seems to be a continuing problem ig should be
> proactive instead of reactive. maybe have the mc at
> the beginning of the show announce that there will be
> a special time during the show for songs requests and
> to therefore please not shout suring the quiet songs.
> and since people seemed worried about gallileo maybe
> even an announcement that it will get play time would
> be in order...
that would be mroe reactive than having them correct the problem as it
happens. in all the times i've seen the girls, i've never seen them correct
aberrant behavior. i'm glad to hear them just getting up there and telling
these morons off. i can bet it works alot better than me telling them to do
it (i have no compunction about telling someone to shut the hell up during a
concert....shocking isn't it?)
ryan
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 10:08:36 -0700
reply-to: jon griffin <jackdavinci@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jon griffin <jackdavinci@yahoo.com>
subject: re: audience confrontation (grrrr)
mime-version: 1.0
content-type: text/plain; charset=us-ascii
my point about being proactive was that, while
chastising the jerks in the audience makes us all feel
good, it doesn't actually help the situation, since
the audience of the whole tour is not part of some
collective consciousness. if ig comments on the bad
behavior in ny, the audience members in chicago or san
francisco or wherever their next tour stop are not
going to be aware of the issue onless they are list
members in which case they probably wont be being
jerks to begin with :-) if they just want to vent
their anger, yelling at jerks is fine. but if they
actually want to change the situation they'll have to
be more creative than that..and that's what my post
was about - trying to get people to think of creative
solutions to actually remedy the situation by
accepting human nature and working with it.
(i apologise in advance to those who might be annoyed
that i am prolonging the beating of this particular
dead horse..)
jon/jack/turtle
jackdavinci@dreamsmithdesigns.com
> that would be mroe reactive than having them correct
> the problem as it
> happens. in all the times i've seen the girls, i've
> never seen them correct
> aberrant behavior. i'm glad to hear them just
> getting up there and telling
> these morons off. i can bet it works alot better
> than me telling them to do
> it (i have no compunction about telling someone to
> shut the hell up during a
> concert....shocking isn't it?)
>
> ryan
=====
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 13:16:50 edt
reply-to: little lis <stopandrest@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: little lis <stopandrest@hotmail.com>
subject: re: the view...
x-to: indigo3000@aol.com
mime-version: 1.0
content-type: text/plain; format=flowed
oh my, oh my. now i have to sit here through the rest of work and pray that
my vcr worked. please, please, please...
>wow...amy and the black tank top are back. tattoo showing and all. hmm..
______________________________________________________
get your private, free email at http://www.hotmail.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 13:28:50 -0400
reply-to: susan brill <susan.brill@yale.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: susan brill <susan.brill@yale.edu>
subject: re: audience confrontation (grrrr)
in-reply-to: <ncbbjhddaliahamkpioheecccjaa.hawke2@email.msn.com>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
i was thinking about the suggestion to be proactive with regard to audience
behavior at the concerts. it is really a tough issue, because it can start
things out with a negative vibe just when you want to connect with everyone
in a really positive way. also, the worst offenders just don't get it anyway.
i saw this happen this past summer. they used the proactive approach at a
neil young acoustic concert. a madison sq. garden theater person came out
before the show and announced that neil requests that there be no smoking,
no drinking in the theater, no flash photography, and no entering or
exiting the theater during the songs. he announced that all this was
because it was a quiet acoustic show and it would allow neil to concentrate
on the music with no distractions. i rejoiced at this announcement, but
there were about 20 people littered in my section who were probably the
worst audience members i have ever witnessed. they broke all of the rules
in a blatant manner and were repeatedly confronted by an aggressive
security. it escalated and they argued about it during songs and came very
close to a fight that would have ruined the show for everyone in the theater.
of course, i have never seen people at an ig concert who were as horrible
as this, and i think amy and emily's current approach is a good one for
their audience. it seemed to me that they reward good audiences with
statements like "thanks for listening" "thanks, that was nice" "this is a
very warm audience, it feels great" (the latter from amy at the final
beacon show). they generally punish bad behavior by not responding, and if
behavior is offensive they address it in a direct but respectful way
(except in the instances when they say or gesture fuck you... but we all
get pushed past our limits sometimes...).
finally, i noticed that the ig are most provoked to speak up when someone
else has been offended by their fans - either the warm up acts or people
sharing the tour with them etc... i love this about them.
i really felt the other night that it was not a case where amy was snapping
back in anger. she spoke honestly with her anger in check. she's dealt with
this one before, and it will continue to be an issue when they sing or with
rose (all the more maddening since it is a truly beautiful song - everyone
should listen and be moved by it! at least i think so). i thought amy's
statement was very appropriate and very well delivered. i hope they keep it
up.
-sue
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 18:26:22 +0000
reply-to: kz123@att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristen curry <kz123@att.net>
subject: re: (nigc) falwell confidential
very irritated and heartfelt post follows. please be
aware i'm specifically talking about the radical
religious right and christians who espouse that doctrine.
jeez. i missed that "and vice versa" the first time
around. that makes me furious.
when was the last time an american christian got
threatened, chased down, beaten, or murdered by an out of
control gang of queens and dykes for practicing the faith
of their choice? i know christians are persecuted in some
parts of the world, but not in this part of the world.
i'm sick to my back teeth of this kind (this kind) of
christian rhetoric that tries to claim they're victims
too. that they've suffered too. in the united states,
that's a lie. this country is ruled, bought and sold by
christianity. that's not even a critisism, it's just the
truth. there are perhaps a handfull of non-christians in
congress, the judiciary and law enforcement nation wide.
it is sickening to see fallwell and his followers wrap
themselves in a mantle of victimhood, as though by
pretending they've endured they can lay claim to the
suffering of those who have been tormented. they don't
have the backbone to take responsibility for the part
their own doctrines play in creating violence.
it's hard to believe they don't revel in the fear and
hatred they inspire with their lies and propogate with
their wealth. they crave superiority, not salvation - a
closer walk with the egocentric, merciless and
blood-drinking god they've built from imagination, bad
dreams, and a gross and willfull missreading of their own
holy text.
what a disgraceful bunch of cowardly frauds.
kc
(who works off the same exit that leads to "focus on the
family".)
> i am calling for all christian
> > ministries to halt any
> > rhetoric that might engender violence against the
> > homosexual
> > community, and vice versa.
>
> ...and vice versa????? excuse me??? i don't think
> this is a problem!
>
> his attitude is still annoying, but at least it is a
> start... i wonder if this conference was born out of
> his recent meeting with mel white (i think) and a
> group of gay people?
>
> peace!
>
> =====
> joan :-d
>
> visit my home page:
> http://www.hometown.aol.com/joanm12345/index.html
> __________________________________________________
> do you yahoo!?
> bid and sell for free at http://auctions.yahoo.com
>
> --
> all listserv commands should be sent to listserv@netspace.org.
> to unsubscribe issue the command: signoff indigo-girls
> for help write to indigo-girls-request@netspace.org.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 15:09:31 edt
reply-to: shannon mast <shannonmast@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: shannon mast <shannonmast@hotmail.com>
subject: re: jonas & ezekiel/conspiracy theory
x-to: gitroop@aol.com
mime-version: 1.0
content-type: text/plain; format=flowed
sorry if this has been posted already--hotmail is slow in receiving.
the names "jonas" and "ezekial" were taken from names amy saw on some
gravestones. at least, that's what i remember reading. is it in the list
faq?? anyone? anyone? :)
shannon
______________________________________________________
get your private, free email at http://www.hotmail.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 12:22:30 -0700
reply-to: joan morrison <morrison_joan@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: joan morrison <morrison_joan@yahoo.com>
subject: re: audience confrontation (grrrr)
mime-version: 1.0
content-type: text/plain; charset=us-ascii
> and no entering or
> exiting the theater during the songs. he announced
> that all this was
> because it was a quiet acoustic show and it would
> allow neil to concentrate
> on the music with no distractions.
moral of the story...don't drink lots of water, tea or
beer before a neil young show. :o)
> finally, i noticed that the ig are most provoked to
> speak up when someone
> else has been offended by their fans - either the
> warm up acts or people
> sharing the tour with them etc
i'm sure this embarasses them to no end...it makes it
look like their fans are rude assholes or something.
does anyone remember the story about amy chastising
the audience during a show on the first tour (1989)? i
read an interview with amy a few years ago wherein she
described the incident. a fight broke out near the
back of the venue among a bunch of teenage girls, and
the girls were fighting, throwing m&ms, etc. everyone
was turning around watch the fight and not paying
attention to the girls. amy screamed out something
like "turn around and sit down!!!!!!" and the place
fell silent and they resumed their song. i love
it!!!! some rock artists don't really care what's
going on out in the audience, but it's nice to know ig
are aware and care.
peace!
=====
joan :-d
visit my home page:
http://www.hometown.aol.com/joanm12345/index.html
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 13:00:21 -0500
reply-to: barbara bordner <barbinmn@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: barbara bordner <barbinmn@webtv.net>
subject: the view
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
i miiiiiiiiiiiiiiiiiiiiissed the view. :-( :-( boo whoooooo! if
anyone of you taped it on your vcr could you dubb it for me?
pleeeeeeeeaaaase?? (with-sugar-and-spice-and-everything-nice??)
i would be willing to pay.
peace,
barb
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 21:40:03 +0200
reply-to: diane halford <dhalford@pcpro-gb.de>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: diane halford <dhalford@pcpro-gb.de>
subject: boots
mime-version: 1.0
content-type: multipart/alternative;
boundary="----=_nextpart_000_000d_01bf1755.d708cb40"
this is a multi-part message in mime format.
------=_nextpart_000_000d_01bf1755.d708cb40
content-type: text/plain;
charset="iso-8859-1"
content-transfer-encoding: quoted-printable
hkf
i have recently got myself a cd burner, and have some time on my hands =
so i am able to be a european branch of any boot tree!! and anywhere =
else if you don't mind the extra delivery time:) let me know if you have =
a boot that you would like to share!
btw did anyone boot the nyc concert on 13 oct 99?? i would love a copy =
of that show! cheers!!
diane
------=_nextpart_000_000d_01bf1755.d708cb40
content-type: text/html;
charset="iso-8859-1"
content-transfer-encoding: quoted-printable
<!doctype html public "-//w3c//dtd html 4.0 transitional//en">
<html><head>
<meta content=3d"text/html; charset=3diso-8859-1" =
http-equiv=3dcontent-type>
<meta content=3d"mshtml 5.00.2614.3500" name=3dgenerator>
<style></style>
</head>
<body bgcolor=3d#ffffff>
<div><font face=3darial size=3d2>hkf</font></div>
<div> </div>
<div><font face=3darial size=3d2>i have recently got myself a cd burner, =
and have=20
some time on my hands so i am able to be a european branch of any =
boot=20
tree!! and anywhere else if you don't mind the extra delivery =
time:) let me=20
know if you have a boot that you would like to share!</font></div>
<div> </div>
<div><font face=3darial size=3d2>btw did anyone boot the nyc concert on =
13 oct 99??=20
i would love a copy of that show! cheers!!</font></div>
<div> </div>
<div><font face=3darial size=3d2>diane</font></div></body></html>
------=_nextpart_000_000d_01bf1755.d708cb40--
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 15:58:41 edt
reply-to: peachy706@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: peachy706@aol.com
subject: igc: the view
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
thanks to all the great folk out there who emailed me the time and station of
the view so i could watch it. i must admit, however, that i was disappointed.
any other reactions? the girls looked great, they sounded great-- i guess i
just expected the interviewer to ask more questions... and i can't believe
how she said (twice!) about the girls not being a couple. i thought that was
fairly common knowledge. how come with heterosexual duos (like soul miner's
daughter ;)... no one ever even asks if they're dating?? it's a conspiracy.
you guys are great-- thanks for always..er.... reading. :) one week til ig
are in athens! have a great weekend, peeps.
katie :)
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 13:13:30 -0700
reply-to: amy teplow <amtep@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: amy teplow <amtep@yahoo.com>
subject: sigc: a call to austinites!
mime-version: 1.0
content-type: text/plain; charset=us-ascii
if there's anybody in austin who taped the view, i'd love to borrow it
and make a copy or whatever. please reply to me privately. thanks a
bunch!
indigo smiles,
amy
=====
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 09:02:53 +1300
reply-to: jane ferrier <janef@ihug.co.nz>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jane ferrier <janef@ihug.co.nz>
subject: re: audience confrontation my 2 cents
in-reply-to: <3847631f.25378a8b@aol.com>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"; format=flowed
>i had the misfoturne of standing next to 4 brain damaged, drunk individuals
>at the 9:30 club in dc august 98. a&e along with sara lee and a few other
>people came out on this balcony off to the side of the stage...well the lame
>brains proceeded to yell "we want the indigo girls" during 3 fingered cowboys
>set...
i get your point, i really do, but speaking from experience of working with
brain damaged people, i can also say that most so afflicted would never
behave in this manner. i suspect the inebriates were 'normal' - sigh...
jane
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 16:10:58 edt
reply-to: arrowofartemis@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: melissa billings <arrowofartemis@aol.com>
subject: re: the view
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
could anyone tell me about what time the girls came on during the show this
morning? i only had about 20 minutes left on my ig archive tape, so i just
set the vcr for that amount of time...eeek...i hope they were near the end!
lol!
thanks!
mis
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 13:14:22 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: qs on the faq <g>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
ok so, i was a good newbie and i read the faq. the whole thing...
really. my condolences to the poor people that had to type all of that
but the info was greatly appreciated! thanks!
...and yes, by the way it does mention the jonas and ezekiel somewhere
in faq-2 i think ;)
i was intrigued by the jesus christ superstar recording and video that
are mentioned in the last faq... and i went to the website that is
supposed to give me more info, but the website no longer exists.
(www.hidwater.com)
anyone know where i could get hold of either or both? i'll be your
best friend ;)
also, does amy's daemon records have a website?
thanks!
jean
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 15:10:04 -0500
reply-to: barbara bordner <barbinmn@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: barbara bordner <barbinmn@webtv.net>
subject: re: (nigc) falwell confidential
in-reply-to: melissa gordon <melissa@ce1.com>'s message of fri, 15 oct 1999
06:57:52 -0700
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
hey everyone,
look who's talking about love and respect to
all god's children (heh, heh,heh) hehloooooh
jerry!!!!!!!!
say mr. falwell, "tell me, why oh why can't you understand why you are
seen as hating
gay people?"
mr. falwell, "duh, ah don't know whah! i'm jst trying to bring to them
the gospel of jesus christ, so
they could reeeeeeepennnnnt their sinful ways. and turn to god now
before their day of judgement."
reporter: "but most of the glbt commuities in this country are very
upset and hurt by things you have said in the past. why does it seem
that many people see that what you are doing,
is hateful?"
mr. falwell: "ahve never said enething to hurt those people, like ah
say, ahm a minister of the lord jesus chrahst, and ah love allll god's
cheeeildren. ah have no hatred in mah hart
for anyone."
reporter: "you always talk about them being damned ."
mr. falwell: "ah do?"
reporter: "yes you do. you said that tinky winky is a symbol of the
glbt cultures here,
and are encouraging people to boycott anything to do wit teltubbies,
because they support glbt."
mr. falwell: " ah didn't mean that."
reporter: "yes you did. you have a history of
making such hateful statements to people wh are not like you, and then
taking it all back, the next day. just like you did now. "
mr. falwell (shaking in fear) " ahm goin' ta meet with the glbt people
and tell them about their sin because god loves them too."
reporter: "that's exactly what i mean. sexual orientation is part of
how god created us all.
and you say they're damned for practicing that gift?"
mr. falwell: "ahv gotta go." (he fumbles through his papers, ( and
pushes reporter out the door.)
reporter, : "mr. falwell, one more question---"
falwell interrupts, "ah said, 'no comment. bah."
reporte, "well, there you have it folks. another
attempt to spread more hatred amongst us. live from jerry falwell
himself. this is barb
reporting so long and peace."
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 15:19:24 -0500
reply-to: sheryl jones <sljones1@facstaff.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sheryl jones <sljones1@facstaff.wisc.edu>
subject: re: qs on the faq <g>
x-to: jean moses <sneakyjean@yahoo.com>
in-reply-to: <19991015201422.12434.rocketmail@web109.yahoomail.com>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
jean--
you can get jcs at daemon:
<http://www.daemonrecords.com>
----------------------------------------------------------
sheryl jones
sljones1@facstaff.wisc.edu
cooper seay page: http://www.geocities.com/felidae/cooper/cooper.htm
bootleg page: http://www.geocities.com/felidae/boots.htm
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 15:20:42 -0500
reply-to: sheryl jones <sljones1@facstaff.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sheryl jones <sljones1@facstaff.wisc.edu>
subject: nigc: butchies
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
if anyone is a big fan of the butchies and is within driving distance of
madison, wi (it's up to you to decide what that means!) i have good news.
the butchies will be playing at union south here on sunday at 8:00. they
will be sharing the bill with the sissies!
----------------------------------------------------------
sheryl jones
sljones1@facstaff.wisc.edu
cooper seay page: http://www.geocities.com/felidae/cooper/cooper.htm
bootleg page: http://www.geocities.com/felidae/boots.htm
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 16:36:19 -0400
reply-to: erica weinstein <eweins1@po-box.mcgill.ca>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: erica weinstein <eweins1@po-box.mcgill.ca>
organization: a woman without a man is like a fish without a bicycle
subject: pictures of ig
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
http://rosieo.warnerbros.com/cmp/oct99/oct99.htm
there are pictures of ig from the rosie show on the website.
erica
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 13:41:40 -0700
reply-to: renee carson <rcarson@rohan.sdsu.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: renee carson <rcarson@rohan.sdsu.edu>
subject: the view - let's write them
in-reply-to: <009501bf1431$79c88280$34c628c3@cableinet.co.uk>
mime-version: 1.0
content-type: text/plain; charset="us-ascii" ; format="flowed"
>and i can't believe how she said (twice!) about the girls not being
>a couple. i >thought that was fairly common knowledge. how come with
>heterosexual duos (like >soul miner's daughter ;)... no one ever
>even asks if they're dating?? it's a >conspiracy.
i agree. it's just not fair. in when harry met sally, the whole movie
jokes about men and women not being able to be "just fiends," so why
is it only gay people that get questions like that?
here's the view's web page:
http://abc.go.com/theview/index.html
there's a link you can click to "write barbara." why don't we write
them and tell them to do their homework better so that they stop
asking guests redundant questions and stop making assumptions about
homosexuals.
~renee
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 16:06:03 -0600
reply-to: justin shumaker <shuey@amarillonet.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: justin shumaker <shuey@amarillonet.com>
subject: re: the view - let's write them
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
> there's a link you can click to "write barbara." why don't we write
> them and tell them to do their homework better so that they stop
> asking guests redundant questions and stop making assumptions about
> homosexuals.
i agree that it's a stupid question to us intimate strangers, however...
i don't think it's a matter of doing homework...if i recall, the view girl
didn't ask
"are you two a couple?",
but rather she said something like
"a lot of people think you're a couple, but you're not, right?"
it wasn't her *asking*, it was her letting the girls clarify it.
and i think amy actually thanked her, saying something like "that's the
first time someone's clarified that from the beginning."
anyway, i thought the girls handled it very well, considering how often they
get asked. and i think it was actually okay to bring it up in the manner
she did...
but...
i think it was entirely inappropriate for the view girl to, after the girls
performed, say "the indigo girls! they're not a couple!"
i mean, how about, "the indigo girls! they rock!" or something...
--
_________________________________
justin shumaker
webmaster
amarillo globe-news online
---------------------->
http://amarillonet.com
shuey@amarillonet.com
(806) 345-3467 | (800) 692-4052
_________________________________
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 14:06:40 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: re: pictures of ig
mime-version: 1.0
content-type: text/plain; charset=us-ascii
erica,
i didn't get to see the show so thanks for the heads up on the pics!
they're so cute... all smiley... :)
jean
--- erica weinstein <eweins1@po-box.mcgill.ca> wrote:
> http://rosieo.warnerbros.com/cmp/oct99/oct99.htm
>
> there are pictures of ig from the rosie show on the website.
>
>
>
> erica
>
> --
> all listserv commands should be sent to listserv@netspace.org.
> to unsubscribe issue the command: signoff indigo-girls
> for help write to indigo-girls-request@netspace.org.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 21:31:30 gmt
reply-to: that loud girl <strange_fire66@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: that loud girl <strange_fire66@hotmail.com>
subject: nigc-subversive fun in the office
mime-version: 1.0
content-type: text/plain; format=flowed
attorney: i'm leaving. forever.
shelley: forever and ever? can i sleep on your couch, then? (noting
attorney's leather couch-clad office).
attorney: sure. as many can sleep on the couch as can fit on it.
shelley: at the same time?
attorney: only if you're the same sex.
(oh, if he only knew...)
;)...
on an ig related tangent, we learned romeo & juliet (the dire straits
version) in my guitar class last night. i kept slipping into fits of amy
ray guitar pounding (and voice belting) instead of whatever tastefully soft
picking pattern the teacher was trying to teach us.
rock on,
shel
______________________________________________________
get your private, free email at http://www.hotmail.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 14:54:31 -0700
reply-to: shannon curnutte <shannonc@oregon.uoregon.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: shannon curnutte <shannonc@oregon.uoregon.edu>
subject: nigc: mandolin
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
this is for any pnw listees... or others willing to pay shipping... i
just noticed today in the uo school paper a classified add with some
random stuff for sale... including a 1930's mandolin! as far as i know,
mandolins aren't that easy to find, so i just thought i'd point this
opportunity out... it's listed for $75, and i have no money to spend on
something like this, but if anyone else is looking for a mandolin, i'll
get in touch with the person for you... or you can do it at
541-741-1769.
email me personally if anyone wants me to get in touch with them for
you...
shannon
--
shannon curnutte
shannonc@oregon.uoregon.edu
"i am certain of nothing but the holiness of the heart's
affections and the truth of imagination" -rilke
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 14:55:49 -0700
reply-to: renee carson <rcarson@rohan.sdsu.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: renee carson <rcarson@rohan.sdsu.edu>
subject: re: the view - let's write them
in-reply-to: <199910152054.qaa18248@znet.groupz.net>
mime-version: 1.0
content-type: text/plain; charset="us-ascii" ; format="flowed"
thank you for clarifying that. i was just responding to a list
member's reaction. i have yet to see it myself. i'm crossing my
fingers that my vcr worked.
~renee
at 4:06 pm -0600 10/15/99, justin shumaker wrote:
> > there's a link you can click to "write barbara." why don't we write
> > them and tell them to do their homework better so that they stop
> > asking guests redundant questions and stop making assumptions about
> > homosexuals.
>
>i agree that it's a stupid question to us intimate strangers, however...
>
>i don't think it's a matter of doing homework...if i recall, the view girl
>didn't ask
>
>"are you two a couple?",
>
>but rather she said something like
>
>"a lot of people think you're a couple, but you're not, right?"
>
>it wasn't her *asking*, it was her letting the girls clarify it.
>
>and i think amy actually thanked her, saying something like "that's the
>first time someone's clarified that from the beginning."
>
>anyway, i thought the girls handled it very well, considering how often they
>get asked. and i think it was actually okay to bring it up in the manner
>she did...
>
>but...
>
>i think it was entirely inappropriate for the view girl to, after the girls
>performed, say "the indigo girls! they're not a couple!"
>
>i mean, how about, "the indigo girls! they rock!" or something...
>
>--
>_________________________________
>justin shumaker
> webmaster
> amarillo globe-news online
>---------------------->
> http://amarillonet.com
> shuey@amarillonet.com
>(806) 345-3467 | (800) 692-4052
>_________________________________
>
>--
>all listserv commands should be sent to listserv@netspace.org.
>to unsubscribe issue the command: signoff indigo-girls
>for help write to indigo-girls-request@netspace.org.
>indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 17:54:47 -0400
reply-to: h <hhusted@bu.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: h <hhusted@bu.edu>
subject: darty commentary/sister (again)
in-reply-to: <19991011222738z43929-10893+728@brimstone.netspace.org>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
this review is old news, i know.
the butchies were stellar!!!!!! i can't express how much they amaze me,
especially when i can see them (behind 2 people only) and hear them clearly
(not echoing off rock basement walls). i'm soooo proud of ig that they're
actively promoting a band as real and true and political as those grrrls.
i'm afraid i frightened those meek folk fans around me by my (rather
repressed) pogoing and singing along. they were wearing matching (again)
outfits, white shortsleeved oxfords with ties. at one point, they covered
(a capella) that n'sync torch song ... and then turned around as one, and
g-a-y was spelled across their shirts. they're so dorky/cool it rocks. a
little birdie booted it for me too. the new album is kool.
i loved this ga show, because the only people willing to deal with the
up-front madness *were* up front, as opposed to people striking
lucky/knowing someone important and getting so close. i like seats too,
but this way all the mellow kids/those on dates were sitting on the back
bleachers, where they still could see, and everyone with energy was front
and center. very different from lowell. and it wasn't a huge press of
people or too hot.
fashion: amy's trousers were a sort of blue supersoft cotton material. the
flag on her red jacket (which she tried repeatedly and unsuccessfully push
up on the arms until giving in to my will and taking it off) was upside
down, because, as she told us in q&a, she had been protesting the u.s.
financial involvement in the mexican government..she hopes one day to flip
it back, "maybe". (i'm not obsessive, i was just sooo close i paid really
good attention). and she had a cute grin when someone yelled (in q&a), "i
like your shirt!" (red st:tng tee). ay-me's a door-ork! hee. i like star
trek too.
from elizabeth's review:
>at one point emily said, "don't go posting that on the internet." but i
>can't remember in refrence to what. anyone?
when the flock of young blonde girls went onstage for the ctf singalong,
emily tsked, "now, don't you tell anyone about this on the internet!" heh.
but i wasn't the first one.
>go
a&e loved that we "raised our hands high". there was sheer bliss on their
faces. fun as ever, but i don't know *why* but this song doesn't work live
as well as i want it to. is it too anthemic? maybe it's better when their
songs are more personal narrative?
> ozilline
gorgeous live. emily and the keyboardist definitely *appear* to be singing
something english in the background of ozzilene, but damn if i can figure
it out.
> compromise
here's where amy's rockstar poses came into play. she goes into a
completely different relationship with her guitar. she's been taking notes
from professor kaia wilson and is even outshining carrie brownstein, tho
she does it a little bit self-consciously than those darlings, like a
grownup learning teenage-jive later in life but still excelling. she's got
the rockstar "strum-a-chord-and-swoop-arm-up-into-air" thing *down*, man.
she seems to really enjoy that electric guitar right out in front of her
and likes to pull it out perpendicular to her body. paper topic:
"phallacies of the guitar merge with modern folk". :)
> andy
a bit of a downer for the crowd, tho' i think it's cute on the album. i
think it would be better if amy took a verse. it's got that languid
swappable feeling. "about a girl who falls in love with a farm boy who
doesn't love her back. c'est l'amour"
> johnny rotten
i thought it was hysterical. a gorgeous lesbian folk icon tearing into a
punky song named after a poser punk on a fricken mandolin about a young
male hellion--*all by herself* on a spotlighted stage. and her audience
eats it up.
one could say the amy-emily song swap is growing more and more jarring on
this tour. it's a wedding/sex dichotomy. but i still love to watch her
play the guitar.
**************************
sister. regarding "milkcow and a mess". i think people are looking too
much at their gateway boxes. ig are bizarre lyricists sometimes (emily
especially on this album), but dairy farming is just too much of a buzzkill
given the context. has anyone that's seen this live noticed what emily was
singing? i haven't yet had the opportunity, and i hope they play it
tomorrow night.
yrs,
h
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 14:59:07 -0700
reply-to: bronwen_besso-smith@sunshine.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: bronwen besso-smith <bronwen_besso-smith@sunshine.net>
subject: re: the view - let's write them
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
here's a copy of the mail i just sent the view...........
i was kind of upset when watching the very short interview segment with
indigo girls today,that so much time was devoted to whether or not they were
a couple,when i believe it is well known that they never have been and are
both in other relationships. i wonder if the same questions would have been
asked of a heterosexual male and female singing duo. i also found it quite
inappropriate when after the girls had finished singing,lisa said something
to the affect of " indigo girls...and they're not a couple!" it didn't seem
to have any real point....something postive about their performance would
have been nice instead.
bron
you can talk a great philosophy, but if you can't be kind to people
every day, it doesn't mean that much to me, it's the little things you
do,it's the little things you say, it's the love that you give along the way
- ani difranco
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 14:58:34 pdt
reply-to: dana maxim <lurker98@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: dana maxim <lurker98@hotmail.com>
subject: re: mumia... n i g c
x-to: neily@netreach.net
mime-version: 1.0
content-type: text/plain; format=flowed
actually, his guilt is not "pretty much established".
a myth repeated --
a reply to vanity fair and the f.o.p.
by c. clark kissinger
"...a myth that, if repeated enough, could begin to carry the authority of
absolute truth." -- buzz bissinger
the real myth in the case of mumia abu-jamal
in 1995, an international movement against the execution of author mumia
abu-jamal came into existence. taken aback, the political establishment in
philadelphia hit upon the idea of using the widow of slain police officer
daniel faulkner as the symbol for a national campaign to demand jamal's
execution. ever since, there has been a concerted attempt to hide the real
issues in the case of jamal, and to project instead the "human interest
story" of a lonely widow, fighting valiantly by herself for justice and for
closure -- her everyday existence tortured by rich hollywood liberals,
radical political activists, and jamal's evil lawyer who feeds them false
information. the august issue of vanity fair magazine, a condé nast
publication aimed at the up and coming, contains yet another rehash of this
official myth.
those voices asking for an impartial examination of what has been a travesty
of justice in jamal's case are waging a very uphill battle against the most
powerful forces in the land.
on the national level, both the congress and the supreme court have been
seeking a return to the era of "states rights," sharply restricting any
federal review of state court justice. major political figures have made it
quite clear that they are prepared to see innocent people executed rather
than have the death penalty itself called into question. in the world
community, only the united states, china, saudi arabia and iran still carry
out executions on a large scale.
the case of mumia abu-jamal has come to crystallize these larger issues for
both sides, and that is why there are such powerful political forces behind
the demand for his execution. as evergreen state college president jane
jervis put it so well, jamal has used his voice "to galvanize an
international conversation about the death penalty, the disproportionate
number of blacks on death row, the relationship between poverty and the
criminal justice system."
we are also talking about philadelphia -- a city synonymous with police
corruption and a racist judiciary. this is the city that the kefauver
committee came to for hearings on ties between the police and the mob. this
is the city of frank rizzo, the infamous racist police chief and mayor, who
took pleasure in attacking black school children and personally arresting
black leaders like malcolm x. this is the city where the leaders of the
fraternal order of police (f.o.p.) were themselves convicted in federal
court of racketeering. philadelphia is the only big city where the federal
justice department brought suit to end police brutality. in the last few
years, scores of persons have been released from prison after it was
revealed that they were framed up by the police. and philadelphia was
recently chosen for a case study on racial prejudice in the application of
the death penalty.
in fact, the real accomplishment of author buzz bissinger is that he is able
to fill eight pages of vanity fair, without ever mentioning the names of any
key players in the anti-jamal campaign such as ed rendell, rick costello,
and mike smerconish.
the idea that those campaigning for jamal's execution are somehow the
underdogs in the political arena borders on ridiculous. after all, it is
maureen faulkner who went to washington to sit on stage with president bill
clinton and attorney-general janet reno, not pam africa of move. it is jamal
who is repeatedly attacked by abc's sam donaldson on 20/20, not the
fraternal order of police. it is jamal, not maureen faulkner, who has been
denounced on the floor of the senate by then minority leader bob dole and in
the house by the current majority whip tom delay. and it is the forces
pushing for jamal's execution that benefit from the feeding frenzy of both
mainstream parties for more and speedier executions, with fewer questions
asked.
the attack on jamal as a journalist
one sure indication that bissinger and vanity fair are out to low ball it,
is their attack on jamal as a journalist. in fact, bissinger claims that
jamal never really reported on police issues at all! but his work in
reporting on police brutality began with his work in the black panther
party, first in philadelphia and then on the national staff of the black
panther newspaper.
rosemari mealy, one of the founders of the black panther party in
philadelphia, recalls jamal's work: "in 1969 there was a major incident
which intensified the work of the party, and that was the killing of a
mentally retarded black youth by a notorious cop named bushwinger on 15th
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
and oxford street. the young lieutenant of information [jamal] spoke to the
murdered youth's family and began to write in such a prolific manner of this
and other wrongdoings of the philadelphia police (having himself been a
victim of their brutality)."
since bissinger can't think of a single instance of jamal taking up the
issue, let me refresh his memory about one highly publicized incident. after
the first police attack on the move house in 1978, where delbert africa was
beaten and kicked by police on live tv, mayor rizzo held an angry press
conference to defend the police action. in response to a question from a
reporter, rizzo lashed out: "they believe what you write, and what you say,
and it's got to stop. and one day, and i hope it's in my career, that you're
going to have to be held responsible and accountable for what you do." the
reporter who questioned the police actions was mumia abu-jamal.
before he was railroaded onto death row, jamal engaged in both print and
radio journalism, and shared in an armstrong award for excellence in radio
journalism. since his imprisonment he has produced two books, written over
420 columns, and produced numerous audio recordings. bissinger conspicuously
avoids mention of "the mumia rule" adopted by the pennsylvania prison system
that now bars all audio and video recording of prisoners by reporters. as
mumia has so eloquently put it, "they don't just want my death, they want my
silence."
the great confession hoax
perhaps the most ridiculous claim in the whole frame up of jamal is that he
loudly confessed to shooting officer faulkner in the hospital emergency
room. it's just so typical of the philly cops, that when they don't have a
case, they make one up.
you would think that if a group of trained police officers heard a suspect
make a public confession, especially in a case where a police officer had
been killed, they would report it. but no such report was made. in fact, the
officer in charge of jamal at the hospital wrote in his report that jamal
made no statement, and this is confirmed by the attending physician.
two months after the night when jamal was shot and then beaten by police, he
filed police brutality charges against them. this made the cops go
ballistic. at a meeting then held between cops and prosecutors, in which an
assistant d.a. suggestively asked if anyone had heard a confession, several
of them suddenly "remembered" that jamal had confessed. why hadn't they
reported it at the time? well, they were just too upset.
when this story was met with the skepticism it deserves, a hospital guard
named priscilla durham (who was a friend of the deceased officer) was the
next to suddenly "remember" that she too had heard the confession. in a lame
attempt to add some credence to the story, she claimed that she had reported
it the very next day to her supervisor. of course, he didn't remember to
tell anybody about it either, nor was he called into court to corroborate
her sudden recall. so what it boils down to is that nobody "remembered" the
confession for over two months, while the only written record from that
evening states clearly that jamal made no statement.
you don't have to be a legal scholar to see this is a pretty weak link in
the case against jamal. so buzz bissinger now jumps into the breach with a
brand new confession tale. only this time the memory lapse is years, not
months. perhaps we should hold a contest to see who can recall hearing jamal
confess after the longest lapse of time!
some years ago, philip bloch was a volunteer with a prison aid society, and
in this capacity he met jamal. jamal remembers him, and remembers that
several years after he last saw bloch, bloch wrote him saying that he had
become convinced that jamal was guilty. apparently bloch's convictions have
now blossomed into retroactive accusations. about bloch's belated charge,
jamal says: "a lie is a lie, whether made today or ten years later. but i
suppose mr. bloch wanted his fifteen minutes of fame in which case i hope he
has received it. i find it remarkable that this rumor turned lie was never
brought to my attention by the author, by mr. bloch himself or by vanity
fair magazine which never contacted me. welcome to snuff journalism."
jamal went on to say, "if ever one needed proof of the state's desperation
here it is. i thank vanity fair, not for their work but for stoking this
controversy, because controversy leads to questioning and one can only
question this belated confession."
the prosecution's case warmed over
journalism students are always told that they must never engage in
"advocacy." but in the real world, all journalists are advocates. the only
question is, for whom? in bissinger's case it's quite clear. he marches
through a presentation of the prosecution's case while carefully avoiding
the most serious evidence to the contrary. for example, bissinger assures us
that four witnesses testified to jamal's guilt. of course, there were ten
eye-witnesses who testified to all or part of the events that led to mumia's
fast track to death row. bissinger simply picks out the four who most
closely agree with the prosecution and ignores the rest. he also
conveniently forgets the special favors given to witnesses who changed their
testimony to suit the prosecution (for a complete rundown on the witnesses,
see "the kgo-tv report" by c. clark kissinger and leonard weinglass).
bissinger dismisses the idea that the shooter could have been a third person
at the scene, then fails to tell his readers that the prosecution withheld
from the defense for thirteen years the fact that the driver's
identification of a third man was found on the dead officer.
on the ballistic evidence, bissinger doesn't seem at all upset over how a
bullet first reported by the medical examiner as being in two fragments and
of .44 caliber, got itself together and became one bullet of .38 caliber.
but then many strange things have happened in police department evidence
lockers. bissinger is very pleased that the metamorphed bullet is
"consistent" with mumia's gun. of course, it's also consistent with tens of
thousands of other guns. if bissinger really wants to play investigative
reporter, he might try to explain how a copper bullet jacket was found at
the scene when the police ballistics expert testified that the bullets in
both faulkner's gun and jamal's gun did not have copper jackets.
so bissinger gives us his own "consistent picture of what happened that
night." not surprisingly, it is identical to the police theory of what
happened, except that it omits how jamal got shot. the police theory is that
jamal runs across the street when he sees a cop beating his brother with a
flashlight. jamal shoots faulkner in the back at close range, and as he's
falling, faulkner gets off one shot at jamal. the gravely wounded jamal then
supposedly walks over and shoots faulkner in the face.
the problem with this story is that it doesn't conform to the evidence or
the testimony. faulkner was not shot in the back at close range, because
there are no powder burns on his clothing. jamal was not shot by faulkner as
he fell, because the trajectory of the bullet in jamal's body is downward,
not upward. and one of the prosecution witnesses (michael mark scanlan)
testifies that someone runs across the street to where faulkner and mumia's
bother are, that there is a shot, and then a second shot after which
faulkner goes down.
what is most annoying about bissinger's hit-piece is the way he cavalierly
attacks the defense, when he actually knows the truth of the matter. for
example, bissinger writes: "there is a question of why witnesses who might
conceivably have been helpful in advancing the defense theory that another
person had shot faulkner were never called." bissinger knows full well why
other witnesses were not called. in the case of officer wakshul, who wrote
in his report that jamal had made no statement at the hospital emergency
room, the defense was told that wakshul was on vacation and was not
available to testify. today we know that he was sitting at home and was
available, but judge sabo would not allow even a day's recess to try to find
him. in the case of other potentially helpful witnesses, either their very
existence was hidden from the defense, or the prosecution refused to give
the defense the addresses and phone numbers where they could be reached.
bissinger also assures us that the massive predominance of blacks on death
row in pennsylvania "has nothing directly to do with the facts of the case."
apparently for bissinger, racial prejudice exists only in the ethereal realm
of statistics, and never impinges on the lives of actual black defendants.
or perhaps a "fact in the case" like the prosecution using eleven peremptory
challenges to knock african-americans off the jury is not an instance of
racial prejudice for bissinger. this is precisely the sort of racial jury
selection that was later outlawed by the u.s. supreme court.
finally, bissinger assures us that the pennsylvania supreme court has
examined jamal's claims and rejected them. here bissinger fails to tell his
readers quite a bit. first, the judge who held the hearings on whether jamal
should be granted a new trial was albert sabo, the same judge who conducted
the original trial in 1982. sabo was past the mandatory retirement age for
judges in pennsylvania, but the chief justice of the pennsylvania supreme
court signed a special order that allowed him to stay on the bench and hear
jamal's new appeal. sabo then quashed most of jamal's subpoenas for
suppressed evidence, and passed on to the supreme court his finding that
there were no errors in the original trial. the pennsylvania supreme court
then rubber stamped sabo's findings about his own conduct in the first
trial. the justices of this court are elected in partisan political
elections, and five of the seven justices were endorsed and supported for
election by the fraternal order of police. further, one of these
f.o.p.-endorsed justices is a former district attorney from philadelphia who
signed all the papers opposing jamal's original appeal.
failure to read the transcript
bissinger repeats the frequent contention of the f.o.p. and prosecution,
that those who support a new trial for jamal have not read "the complete
trial transcript." of course he fails to mention that the transcripts of the
1982 trial, and the hearings for a new trial in 1995, 1996, and 1997, come
to 12,306 pages, to which one can add thousands more pages of briefs and
motions by both sides. the plain fact is that virtually no one, on either
side of the issue, has read all the transcripts, nor do they have to in
order to understand that jamal never got a fair trial.
certainly bissinger hasn't read the transcripts, otherwise he would not make
gross factual errors like saying that the defense called the 1995 witness
who claimed that two different people shot officer faulkner, and that one of
them jumped in a car and sped away. that witness, william harmon, was called
by judge sabo over the strenuous objection of the defense, precisely because
he was not credible. also, judge sabo's first name is albert, not "alfred"
as bissinger writes.
bissinger goes on to ridicule author alice walker for only having read "bits
and pieces" of the transcript. yet "bits and pieces" of the transcript is
exactly what f.o.p. has on its "justice for daniel faulkner" web site, and
bissinger doesn't seem upset about that at all.
the f.o.p. frequently makes the claim that only people outside of
philadelphia support jamal's bid for a new trial, but there are actually
many people in philadelphia who support a new look at jamal's conviction.
many of them have experienced "philadelphia justice" first hand, and know
what life is like in the "deep north." but people who speak up for mumia in
philadelphia do so at great risk. in other parts of the country and
internationally, many thousands more have taken the time to look into the
facts of the case, causing them to join the call for justice for jamal.
most people who examine this case for the first time find the case against
jamal so weak, and the procedures of his trial so flawed, that justice
demands a fresh look in an unbiased venue. as author e.l. doctorow put it so
well: "it's inconceivable to me that unless someone has some political stake
they would not want some further examination of the whole thing."
someone with a political stake
one person who clearly has a political stake in the outcome of jamal's
appeals is buzz bissinger. judges and other government officials are
supposed to reveal when they have an interest in a pending decision.
unfortunately, journalists are exempt from this rule.
so who is buzz bissinger? bissinger was a long-time reporter for the
philadelphia inquirer and something of a figure in philadelphia politics.
bissinger picked up a pulitzer prize for a series on the philly courts, but
was best known for covering mayoral politics in philly. bissinger and the
inquirer were aligned with those forces opposed to any political comeback by
former mayor frank rizzo. the sixties were over, nixon had fallen, and the
openly racist, head-cracking style of rizzo was no longer wanted by
philadelphia's elite. politicians like wilson goode and ed rendell were now
slated to take the reins.
but in 1987, an aging frank rizzo made a comeback attempt. bissinger was
assigned by the inquirer to cover his campaign. the anti-rizzo articles
written by bissinger were credited by most observers with tipping this close
election to wilson goode. the service was not forgotten, and when ed rendell
replaced goode in the 1991 election, bissinger was invited into the mayor's
office -- literally. rendell gave bissinger complete access to his office
and operations for the four years of his first term in office. this was not
an act of altruism on rendell's part. the quid pro quo was that bissinger
would write a book on rendell.
bissinger's book, a prayer for the city (vintage: 1997), is a lyric hymn of
praise for ed rendell. bissinger credits rendell with "saving philadelphia"
by crushing the public employee unions and slashing city services -- sort of
a giuliani before his time. the book is filled with vignettes of civic
figures, who are all conveniently classified as good guys or bad guys.
should we be surprised that most of bissinger's good guys are white and most
of his bad guys are black?
although rendell was part of the new generation that overthrew frank rizzo,
it was something of a palace coup. rendell was also a product of the rizzo
era, serving as district attorney while rizzo was mayor. with rendell now
reaching the end of his second term and barred by law from running for mayor
again, he is looking at higher office. rendell's name has been touted for
governor and for the senate.
the eight-foot skeleton in rendell's closet, as he now goes for higher
office, is that rendell was district attorney in 1978 when the police first
attacked move (beating and kicking move members on live tv); rendell was
district attorney in 1982 when jamal was railroaded onto death row; and
rendell was district attorney in 1985 when police dropped a bomb on the move
house killing 11 people (including 5 children) and burning down a black
neighborhood.
if jamal is now vindicated -- if he is shown to have been framed up and a
victim along with the move organization of a deliberate miscarriage of
justice -- then someone is going to ask: "on whose watch did this occur?"
thus we find in vanity fair a marriage of convenience. the larger political
agenda of pushing ahead the death penalty, in this case against a well-known
political dissident on very suspect grounds, is married to the political
interests of one politician and his personal publicist, buzz bissinger.
at the same time, by running out the widow-fighting-by-herself myth,
bissinger seeks to hide the role of rick costello of the fraternal order of
police. unfortunately for the official myth, costello has a big mouth and is
constantly bragging about the f.o.p. raising the money and organizing the
campaign for jamal's execution (operated through a pennsylvania dummy
corporation, "justice for p/o daniel faulkner, inc."). nor does bissinger
tell his readers about the chief cheerleader role of michael smerconish. on
april 23, smerconish organized 800 people to come to a $100 a plate dinner
at philadelphia's elite union league club to raise money to campaign for
jamal's execution. as bissinger well knows, smerconish was a loyal side-kick
and aide-de-camp to rizzo and has served as a lawyer for the f.o.p.
vanity fair was warned in advance about bissinger's bias, but decided to
proceed with his story.
unanswered questions
when you can't answer the tough questions, you try to shift the terms of
debate. and this is what bissinger has to do. he talks about the
widow-fighting-by-herself-myth, he talks about newly remembered confessions,
he talks about mumia's attorney defending political prisoners in other
countries besides the u.s. he talks about everything except how blacks were
deliberately knocked off mumia's jury, how evidence was suppressed, how
mumia's political statements from ten years earlier were used as an argument
to the jury for giving him the death penalty, and how there is an
overwhelming pattern of police and prosecutorial misconduct in philadelphia.
and with good reason. the facts are not a favorable ground for the f.o.p.
and the state to fight on. this is why they resort to emotional appeals
based on the widow. she has become a stage prop used by others in a campaign
to perpetuate a great injustice, and to extend a national program of callous
disregard for rights of those accused.
the vanity fair article ends with the standard demand that jamal give the
prosecutors a free preview of how he will testify in federal court when his
petition for habeas corpus is heard this fall. well, buzz, if you want to
know, come sit in the courtroom and listen. in the meantime, you will have
to make do with what jamal said at the close of his sham trial in 1982:
"i am innocent of these charges that i have been charged of and convicted
of, and despite the connivance of sabo, mcgill and jackson to deny me my
so-called rights to represent myself, to assistance of my choice, to
personally select a jury who's totally of my peers, to cross-examine
witnesses, and to make both opening and closing arguments, i am still
innocent of these charges.
"according to your so-called law, i do not have to prove my innocence. but,
in fact, i did have to by disproving the commonwealth's case. i am innocent
despite what you 12 people think and the truth shall set me free.
"this jury is not composed of my peers, for those closest to my life
experiences were intentionally and systematically excluded, peremptorily
excused. only those prosecution prone, some who began with a fixed opinion
of guilt, some related to city police, mostly white, mostly male remain. may
they one day be so fairly judged."
* * *
----original message follows----
from: neil <neily@netreach.net>
reply-to: neil <neily@netreach.net>
to: indigo-girls@netspace.org
subject: re: mumia...
date: thu, 14 oct 1999 19:02:03 -0400
hey...
*neil may, as usual, be playing devil's advocate in some parts 'cause it's
fun...*
>by the way, can anyone tell me who's mumia abu-jamal? sorry for this
stupid
>question.
he's a former journalist (?) who killed philadelphia police officer daniel
faulkner in the early 80s. if i remember correctly, office faulkner had
pulled over his brother at the time and a scuffle ensued.
(mumia wasn't his name at the time, he changed it later. not that that's
particularly relavent).
his guilt is pretty much established. in addition there was a recent story
on an admission he made while in prison.
which begs the question: if you believe someone guilty , but are strongly
against the death penalty, how can you, in good concience, join with the
people who don't want him dead when they have the slogan 'free *name*'?
neil
@}--,--'---
abi's page!!! http://www.netreach.net/~andineil/abi/abi.html
this week, neil 'as been been mostly listening to:
richard shindell 'reunion hill'; lou dalgleish 'calmer'; the jam 'live/dig
the new breed'; bo diddley 'the chess box'
song o' the week: 'nessum dorma' - aretha franklin
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
______________________________________________________
get your private, free email at http://www.hotmail.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 18:06:37 -0400
reply-to: neil <neily@netreach.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neil <neily@netreach.net>
subject: re: the view
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
*sigh*
<<and i can't believe how she said (twice!) about the girls not being
couple. i thought that was fairly common knowledge. how come with herosexual
duos no one ever even asks if they're dating?? it's a conspiracy.>>
<<i agree. it's just not fair.>>
i really shouldn't have to do this... in fact, i'm not even going to bother
to get this quote, i'm just paraphrasing. but if you don't belive me (and
this could just be part of the conspiricy - you know what they're like to
disprove...) then deal.
and interview with roxette (80s pop at its finest) in thier look sharp tour
program (1990 or so). (they're a man and a woman and, as far as i care,
straight)
-what's the question you get asked the most?
-are you now or have you ever been a couple?
-and the answer?
-no
<<there's a link you can click to "write barbara." why don't we write them
and tell them to do their homework better so that they stop asking guests
redundant questions and stop making assumptions about homosexuals.>>
because interviewers have ask questions people want to hear the answers to.
the interviewer may know everything there is to know about the indigo girls
but most viewers don't and the purpose is to educate them. so for this show
'who writes the songs ?' would be a valid question, whereas 'how's daemon
doing?' would not be (without of course, prior explanation).
oh, wait, y'all were being sarcastic, right?
gotta love this devil's advocate lark. i might take this up full-time again
:o)
neil
@}--,--'---
abi's page!!! http://www.netreach.net/~andineil/abi/abi.html
this week, neil 'as been been mostly listening to:
richard shindell 'reunion hill'; lou dalgleish 'calmer'; the jam 'live/dig
the new breed'; bo diddley 'the chess box'
song o' the week: 'nessum dorma' - aretha franklin
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 18:53:41 edt
reply-to: scarybiker@cs.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: rick b sayre <scarybiker@cs.com>
subject: miami herald's review of cons :)
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 10/15/99 12:02:58 pm eastern daylight time,
melissa@ce1.com writes:
> imagine a black tv screen.....las vegas doesn't "carry" the view.
>
i have to add my tale to the rest... imagine power outages due to heavy
storming, a result of hurricane irene. waah!
miami herald review of cons:
indigo girls deftly balance guitars, melodies
on their seventh studio album, indigo girls amy ray and emily saliers have
hit a perfect medium of rock guitars, lush harmonies, stylistic expansion and
beautifully crafted melodies that come together for one of the most
satisfactory albums of the season.
quite often, these aren't the indigo girls many fans are used to, but their
added punch- including backing vocals from joan osborne in go- only
highlights the girls' capacity to do many things and do them well.
the duo rocks in we are together, also with osborne backing, and then turns
evocative in gone again, where sheryl crow does the honors in the back-ups
over the strumming of a homey banjo.
there are also the anthems to everywomen everywhere... the kind of stuff
that has made the indigo girls beloved to millions. and of course, there are
personal touches, like ozilline, ray's appalachian-laced tribute to her
grandmother ozilline walker.
but even here, the girls have a knack for touching the listener, if not
with the lyrics, with the breadth of musicality and thought apparent behind
every chord. this is the kind of growth all pop artists should enjoy.
-leila cobo, miami herald
must go now before the power flashes again!! :)
rick
*i guess it comes apart so little by little
you don't know you're there till you're stuck in the middle* -emily saliers
<a href="http://members.aol.com/rbsayre/cheese.html">sweet page o'mine</a>
*there ain't no way i'm gonna let this heart mend* -amy ray
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 18:54:00 edt
reply-to: joanm12345@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: joan morrison <joanm12345@aol.com>
subject: re: nigc: mandolin
x-to: shannonc@oregon.uoregon.edu
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
>>mandolins aren't that easy to find, so i just thought i'd point this
opportunity out... it's listed for $75, >>
hey! there are tons for sale on e-bay...not always for $75, but there's lots
available. same with banjos!
peace!
joan :-d
========
visit my home page:
http://hometown.aol.com/joanm12345/index.html
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 19:08:26 edt
reply-to: iudoremi@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: iudoremi@aol.com
subject: re: nigc: butchies
x-to: sljones1@facstaff.wisc.edu
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 99-10-15 16:22:03 edt, sljones1@facstaff.wisc.edu writes:
<< if anyone is a big fan of the butchies >>
i don't care how far you have to drive. their music kicks ass (and i'm new
to the hard core rock scene), and they're totaly hot!!! :) sorry. bring on
the flames.....
carrie
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 19:08:58 edt
reply-to: lisa071573@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lisa r <lisa071573@aol.com>
subject: the view and a marriage proposal
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
well i haven't been home yet to see if my vcr did tape...but i am just
recently discovering this wealth of info about the girls that is available on
the net...i've loved them for about 8 years but i never knew if they were a
couple or not...(sorry if that makes me less of a fan) the first time i ever
heard them say they had never been together was on the vh1 behind the music
of lilith fair. i'm glad they were asked...when i mentioned to people what
kind of music i listen to, a lot of (ignorant) people say to me "the indigo
girls..did you know they're gay? isn't one of them sleeping with melissa
etheridge?" so really, any interview that clarifies the truth to the rest of
the world who doesn't listen to them can't hurt..
on another note, kristen curry - i love your take on jerry falwell!! will you
marry me? as an atheist (and bisexual) in this christian-run country, people
like falwell make me so angry...
lisa
~"mary, you were so real to me...mr. grant had nothing on you...you could
speak your mind yet be polite, you were a paradox in a pantsuit.." barbara
kessler
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 16:24:22 -0700
reply-to: shannon curnutte <shannonc@oregon.uoregon.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: shannon curnutte <shannonc@oregon.uoregon.edu>
subject: re: the view - let's write them
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
justin shumaker wrote:
> i agree that it's a stupid question to us intimate strangers, however...
>
> i don't think it's a matter of doing homework...if i recall, the view girl
> didn't ask
>
> "are you two a couple?",
>
> but rather she said something like
>
> "a lot of people think you're a couple, but you're not, right?"
>
> it wasn't her *asking*, it was her letting the girls clarify it.
>
> and i think amy actually thanked her, saying something like "that's the
> first time someone's clarified that from the beginning."
i agree that this is a good thing... we have to face it that there are a
lot of people out there who don't know much about ig, and automtically
assume that 2 lesbians who perform together are a couple. not that it
should matter, or is really anyone's busness... but it's nice not to
have people making false assumptions about you.
the one thing that struck me as funny was that the view interviewer did
say something to express that she was just clarifying the point... but
that wasn't how she said it. she used the phrase " get it straight", or
somethng along those lines... and that phrase was repeated about 4-5
times within the very, very short conversation. considering what they
were talking about, i thought it was sort of funny...
>
> anyway, i thought the girls handled it very well, considering how often they
> get asked. and i think it was actually okay to bring it up in the manner
> she did...
>
> but...
>
> i think it was entirely inappropriate for the view girl to, after the girls
> performed, say "the indigo girls! they're not a couple!"
>
> i mean, how about, "the indigo girls! they rock!" or something...
>
--
shannon curnutte
shannonc@oregon.uoregon.edu
"i am certain of nothing but the holiness of the heart's
affections and the truth of imagination" -rilke
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 23:31:47 +0000
reply-to: kz123@att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristen curry <kz123@att.net>
subject: re: the view and a marriage proposal
laugh! damn. two proposals in one day. i gotta post more.
(love y'all, but it would make my honey sad... at least
that's what i like to think)
kc
> on another note, kristen curry - i love your take on jerry falwell!! will you
> marry me? as an atheist (and bisexual) in this christian-run country, people
> like falwell make me so angry...
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 19:31:16 -0400
reply-to: bonnie lacey <blacey@aye.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: bonnie lacey <blacey@aye.net>
subject: re: the view
x-to: sarah brady <sbrady1@email.unc.edu>
mime-version: 1.0
content-type: multipart/alternative;
boundary="------------5c00a60fc63e4d1801b1ede7"
--------------5c00a60fc63e4d1801b1ede7
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
hey all,
for those of you who don't remember, i'm straight, but it pisses me off how every
media outlet just doesn't know how to deal with ig. i am so sick of hearing that
question, and i totally agree that they wouldn't get that question if they were
straight. i would say more but i don't dare the flamage. i think i just made up a
word!
who else is loving the nod to motown on peace tonight? it's perfect. the bouncy
beat, the trumpets, it's downright perky.
i also love the sound of the grandma's voice - sounds like a million alabamans i
know....
xoxo,
bonnie
--------------5c00a60fc63e4d1801b1ede7
content-type: text/html; charset=us-ascii
content-transfer-encoding: 7bit
<html>
hey all,
<p>for those of you who don't remember, i'm straight, but it pisses me
off how every media outlet just doesn't know how to deal with ig.
i am so sick of hearing <b>that question</b>, and i totally agree that
they wouldn't get that question if they were straight. i would say
more but i don't dare the flamage. i think i just made up a word!
<p>who else is loving the nod to motown on peace tonight? it's perfect.
the bouncy beat, the trumpets, it's downright perky.
<p>i also love the sound of the grandma's voice - sounds like a million
alabamans i know....
<p>xoxo,
<p>bonnie</html>
--------------5c00a60fc63e4d1801b1ede7--
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 19:44:27 -0400
reply-to: bonnie lacey <blacey@aye.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: bonnie lacey <blacey@aye.net>
subject: re: darty commentary/sister (again)
x-to: h <hhusted@bu.edu>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
> one could say the amy-emily song swap is growing more and more jarring on
> this tour. it's a wedding/sex dichotomy. but i still love to watch her
> play the guitar.
what does this mean exactly? thanks!
bonnie
>
>
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 17:40:51 -0700
reply-to: graham ames <mcgee@oregontrail.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: graham ames <mcgee@oregontrail.net>
subject: the view interview (was re: the view -- let's write them)
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
shannon curnutte wrote:
> the one thing that struck me as funny was that the view interviewer did
> say something to express that she was just clarifying the point... but
> that wasn't how she said it. she used the phrase " get it straight", or
> somethng along those lines... and that phrase was repeated about 4-5
> times within the very, very short conversation. considering what they
> were talking about, i thought it was sort of funny...
actually, i was noticing that, myself... actually, i thought that amy's
reply about "people setting us straight" was more a sarcastic comment
about the interview question itself, rather than being said in
appreciation. at first i thought i was crazy, but i think the subtext
in that short exchange spoke a lot more than just the words implied...
--
graham ames
mcgee@oregontrail.net
http://www.oregontrail.net/~mcgee/
icq: 3857882 aol-im: hipebear
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 21:22:05 edt
reply-to: lisa071573@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lisa r <lisa071573@aol.com>
subject: the view again
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
ok i just had to say...i finally got home and watched the view...and i loved
it! the girls looked sooooo gorgeous (love amy's blondish hair :) and they
looked very cute smiling so much. if you rewind it and listen again, when the
girl says something about setting "it straight" emily says, "no pun intended"
heehee :) that's so cute! and amy did seem to appreciate the question -- "no
one's ever clarified that before." i thought it was terrific. and the bit at
the end, where the chick said "and they're not a couple!" - that was a joke -
funny :) everyone needs to relax a bit...we were bitching and moaning cause
rosie didn't even let them say a word, and now we're upset that someone asked
them about being gay...yikes.
love the girls and be happy :)
can't wait for berkeley!
lisa
~"jesus had wonderful things to say, but christianity is dickless." tori amos
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 12:02:11 +1000
reply-to: sherlyn koo <sherlyn@fl.net.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sherlyn koo <sherlyn@fl.net.au>
subject: re: qs on the faq <g>
in-reply-to: <19991015201422.12434.rocketmail@web109.yahoomail.com>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
jean said:
>ok so, i was a good newbie and i read the faq. the whole thing...
... speaking of which, a faq update will be forthcoming,
hopefully fairly soon... yeah, i know, i said that last
time but i really will do it this time...
:)
sherlyn
=-= sherlyn koo - sherlyn@fl.net.au =-=-=-=-=-=-= [sydney, australia]
"raise your hands, raise your hands high,
don't take a seat, don't stand aside this time,
don't assume anything, just go go go" - indigo girls
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 22:08:11 -0400
reply-to: neil <neily@netreach.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neil <neily@netreach.net>
subject: mumia again (nigc again)
mime-version: 1.0
content-type: multipart/alternative;
boundary="----=_nextpart_000_0188_01bf1759.c4f238c0"
this is a multi-part message in mime format.
------=_nextpart_000_0188_01bf1759.c4f238c0
content-type: text/plain;
charset="iso-8859-1"
content-transfer-encoding: quoted-printable
forgive the intrusion, i realized that what i thought had been posted to =
me privately also went to the list, so i figured i'd just say this:
there are two sides to every story. if you're interested in this case i =
would direct you to this site:
http://www.danielfaulkner.com/splash.htm
specifically the 'myths about mumia' section, which gives responses to =
many of the issues raised by the pro mumia group, (who/which can be =
found at www.mumia.org )
although both sides offer some unnecessary and distracting innuendo.
is mumia innocent because he has a lot of support and the indigo girls =
(may?) perform at a rally in support of him?=20
no.
but it doesn't mean he's guilty either.=20
i guess you have to make up your own mind... i just hope they don't kill =
the guy - i guess that's the priority at the moment...
devil's advocacy at it's finest :o)
neil
@}--,--'---
abi's page!!! http://www.netreach.net/~andineil/abi/abi.html
this week, neil 'as been been mostly listening to:
richard shindell 'reunion hill'; lou dalgleish 'calmer'; the jam =
'live/dig the new breed'; bo diddley 'the chess box'
song o' the week: 'nessum dorma' - aretha franklin
------=_nextpart_000_0188_01bf1759.c4f238c0
content-type: text/html;
charset="iso-8859-1"
content-transfer-encoding: quoted-printable
<!doctype html public "-//w3c//dtd html 4.0 transitional//en">
<html><head>
<meta content=3d"text/html; charset=3dwindows-1252" =
http-equiv=3dcontent-type>
<meta content=3d"mshtml 5.00.2014.210" name=3dgenerator></head>
<body bgcolor=3d#ffffff>
<div>forgive the intrusion, i realized that what i thought had been =
posted to me=20
privately also went to the list, so i figured i'd just say =
this:</div>
<div> </div>
<div>there are two sides to every story. if you're interested in this =
case i=20
would direct you to this site:</div>
<div><a=20
href=3d"http://www.danielfaulkner.com/splash.htm">http://www.danielfaulkn=
er.com/splash.htm</a></div>
<div>specifically the 'myths about mumia' section, which gives responses =
to many=20
of the issues raised by the pro mumia group, (who/which can be found at =
<a=20
href=3d"http://www.mumia.org">www.mumia.org</a> )</div>
<div>although both sides offer some unnecessary and distracting =
innuendo.</div>
<div> </div>
<div>is mumia innocent because he has a lot of support and the indigo =
girls=20
(may?) perform at a rally in support of him? </div>
<div>no.</div>
<div>but it doesn't mean he's guilty either. </div>
<div>i guess you have to make up your own mind... i just hope they don't =
kill=20
the guy - i guess that's the priority at the moment...</div>
<div> </div>
<div>devil's advocacy at it's finest :o)</div>
<div> </div>
<div>neil</div>
<div>@}--,--'---</div>
<div> </div>
<div>abi's page!!! <a=20
href=3d"http://www.netreach.net/~andineil/abi/abi.html">http://www.netrea=
ch.net/~andineil/abi/abi.html</a><br>this=20
week, neil 'as been been mostly listening to:<br>richard shindell =
'reunion=20
hill'; lou dalgleish 'calmer'; the jam 'live/dig the new breed'; bo =
diddley 'the=20
chess box'<br>song o' the week: 'nessum dorma' - aretha=20
franklin</div></body></html>
------=_nextpart_000_0188_01bf1759.c4f238c0--
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 12:12:49 +1000
reply-to: sherlyn koo <sherlyn@fl.net.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sherlyn koo <sherlyn@fl.net.au>
subject: fw: ig show (10/12) boot, and wfuv show
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
this is forwarded from the news list... please direct your
replies to d6309@prodigy.net, not to me...
cheers,
sherlyn
---begin forwarded message---
>from: "donna m schwartz" <d6309@prodigy.net>
>subject: [ig-news] ig show (10/12) boot, and wfuv show
>date: fri, 15 oct 1999 21:24:12 -0400
>
>hey all,
>i was fortunate enough to tape the 10/12 show. i think the sound quality is
>good, but a little bit too much bass at times, probably because i had the
>recorder in a bag on the floor, which was seriously vibrating. (how's that
>for a run-on sentence!)
>
>i also live in the ny area, so i was also able to tape the wfuv radio
>interview with rita houston on 10/12. it was phenominal! this, i think, is
>one interview you will want to have. ig were on for 40 minutes, they played
>a few tunes (peace tonight, gone again,power of two) and talked about some
>things that most interviewers don't ask.
>
>i want to set up a tree for both of these, so only those of you interested
>(i need about 12) in being a branch please contact me privately at:
>
>d6309@prodigy.net
>
>i hope to get this started soon.
>thanks,
>donna
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 20:06:18 -0700
reply-to: beccie lyon <dovesland@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: beccie lyon <dovesland@yahoo.com>
subject: re: (nigc) falwell confidential
x-to: melissa gordon <melissa@ce1.com>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
i know i know he has decided to run for president
hasnt he? that's why he has said this....(toung very
much in cheek)
--- melissa gordon <melissa@ce1.com> wrote:
> now, what would mr. fallwell say to that reverend
> who has picketed matthew
> shepard's trial, funeral etc (wildmon, i think his
> name)?
>
> melissa
>
> >
> > jerry falwell writes:
> >
> > << media appearances: on monday, october 8, i will
> be appearing on
> > msnbc's internight, with host john gibson
> (7:00-8:00 p.m., et). i
> > will be discussing the summit i am hosting next
> week (october 23,
> > 24) in which i am calling for all christian
> ministries to halt any
> > rhetoric that might engender violence against the
> homosexual
> > community, and vice versa. as i have reported, i
> remain committed
> > to preaching that homosexuality is sin, as
> described in the bible.
> > however, i feel compelled to lead this charge of
> anti-violence from
> > the conservative christian perspective. we will
> never reach
> > homosexuals with the gospel of jesus christ if we
> preach from a
> > malicious standpoint. i believe that god hates
> the sin of every man
> > ... yet he invites us all - equally - through his
> divine grace, so
> > that we may become "new creatures" in him.
> please pray for me as i
> > host this meeting that will have many homosexual
> leaders present. >>
> >
> > --
> > all listserv commands should be sent to
> listserv@netspace.org.
> > to unsubscribe issue the command: signoff
> indigo-girls
> > for help write to
> indigo-girls-request@netspace.org.
> > indigo girls faq and indigo girls mailing list
> faq:
> > http://www.fl.net.au/~sherlyn/ig
> >
>
> --
> all listserv commands should be sent to
> listserv@netspace.org.
> to unsubscribe issue the command: signoff
> indigo-girls
> for help write to indigo-girls-request@netspace.org.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
=====
peace, love & indigo light
beccie lyon
may the path that you are on take you above
your expectations for the road ahead
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 22:06:57 -0500
reply-to: barbara bordner <barbinmn@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: barbara bordner <barbinmn@webtv.net>
subject: fwd: re: the view again
content-type: multipart/mixed; boundary=webtv-mail-24493-1901
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
--webtv-mail-24493-1901
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
--webtv-mail-24493-1901
content-disposition: inline
content-type: message/rfc822
content-transfer-encoding: 7bit
x-webtv-signature: 1
etasahrfvjlt2uq9yareqvamnewzjqnunwiuaji/fluweb0tekeg1yopjtxr9fg=
from: barbinmn@webtv.net (barbara bordner)
date: fri, 15 oct 1999 22:03:35 -0500 (cdt)
to: lisa071573@aol.com
subject: re: the view again
message-id: <12475-3807eb07-3041@postoffice-293.iap.bryant.webtv.net>
in-reply-to: lisa r <lisa071573@aol.com>'s message of fri, 15 oct 1999
21:22:05 edt
content-disposition: inline
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
i look forward to the girls when they are on tv. that's too bad that
they never made the late late show w tom snyder, because they could
easily have filled up a whole hour. and tom snyder was one f the best
interviewers in the business. and certainly
a lot better than craig kilborn anyday. (that's coming from someone in
the 18-35 age group btw if that makes any difference.) he had so much
more depth.
and it didn't seem to matter to him, what sexuality a person was.
unlike the women on the view.
barb
--webtv-mail-24493-1901--
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 21:04:31 -0700
reply-to: jon griffin <jackdavinci@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jon griffin <jackdavinci@yahoo.com>
subject: re: (nigc) falwell confidential
mime-version: 1.0
content-type: text/plain; charset=us-ascii
i couldn't help thinking this sounds like something
out of an episode of star trek or a b grade horror
movie...
makes god sound like the 'mother' alien :)
--- beccie lyon <dovesland@yahoo.com> wrote:
> > > jerry falwell writes:
<snip>
> > i believe that god hates
> > the sin of every man
> > > ... yet he invites us all - equally - through
> his
> > divine grace, so
> > > that we may become "new creatures" in him.
=====
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 00:00:24 edt
reply-to: emt220@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: b diamond <emt220@aol.com>
subject: concert tickets on ebay
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i'm wondering if anyone has tried buying indigo girls concert tickets off of
www.ebay.com and have you had good luck doing so? i have seen some good seats
on there but i'm not really sure how it works.
b.d.
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 21:09:13 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: re: the view again
mime-version: 1.0
content-type: text/plain; charset=us-ascii
having finally seen this for myself (my vcr worked! yay!) i have this
to say:
was that emily's sister they cut to during the interview (dark haired
woman after they are introduced)? had to be they looked so alike...
anyone know which one it was?
i'm usually an emily girl, but i loved amy's hair! really thought amy
was looking particularly beautiful!
i'm still so intrigued by the mix of instruments these girls use...
emily on electric this time, an accordion and a really cool electric
cello. very neat.
i always want to tell them to stop playing and hold their hands out so
i can see their rings/bracelets etc ;)
and, after all the chat about how appropriate it was to ask them if
they were a couple, it seemed like they actually were very relaxed
about saying "no" and amy even said "no one's ever really done that..
set the record straight"... and despite the bad pun, it made me think
she actually appreciated the opportunity to once and for all state the
facts jack ;)
as for the end of the song, the joke went over ok... it was a little
lame, but i don't think it was insulting.
just my 2 cents.
jean
--- lisa r <lisa071573@aol.com> wrote:
> ok i just had to say...i finally got home and watched the view...and
> i loved
> it! the girls looked sooooo gorgeous (love amy's blondish hair :) and
> they
> looked very cute smiling so much. if you rewind it and listen again,
> when the
> girl says something about setting "it straight" emily says, "no pun
> intended"
> heehee :) that's so cute! and amy did seem to appreciate the question
> -- "no
> one's ever clarified that before." i thought it was terrific. and the
> bit at
> the end, where the chick said "and they're not a couple!" - that was
> a joke -
> funny :) everyone needs to relax a bit...we were bitching and moaning
> cause
> rosie didn't even let them say a word, and now we're upset that
> someone asked
> them about being gay...yikes.
> love the girls and be happy :)
> can't wait for berkeley!
> lisa
> ~"jesus had wonderful things to say, but christianity is dickless."
> tori amos
>
> --
> please do not send long non-indigo girls-related forwards to the
> list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 00:29:38 edt
reply-to: grrrly4354@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: grrrly4354@aol.com
subject: rosie pics
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
on the first pic on the site, emily just looks content to eat that
microphone:)
pax, celeste
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 00:45:32 edt
reply-to: lance longwell <longwell_ls@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lance longwell <longwell_ls@hotmail.com>
subject: ig asbury park review (10/17) ... indigo girls in the ghetto
mime-version: 1.0
content-type: text/plain; format=flowed
folks, don't know how else to say this, but asbury park was a total ghetto.
the venue was very run down. the neighborhood had bombed out buildings,
houses all boarded up...it was bad. cars with the wheels stripped off. the
question i kept asking myself is why ig would play a show in a place as bad
as asbury park. the only good thing was that it was on the ocean....
opener: ph balance. everytime i see them i'm a little less thrilled.
fashion:
emily--camo pants, white shirt, blue/black checked overshirt, black leather
boots.
amy--black nylon pants, print silk top, blue suede shoes.
setlist:
go
trouble
chickenman
everything in it's own time
gone again
peace tonight
kid fear's
closer to fine
ozilline
soon to be nothing
shed your skin
cold beer and remote control
johnny rotten
philosphy of loss
get out the map
sister
least complicated
shame on you
encore:
wood song
faye tucker
galileo
highlights:
chickenman--always good to see live! amy did a little ditty and threw in
some fun extra lyrics. but no soc.
everything in it's own time--i hadn't heard this one since the winter tour
of 1997. i still love this song! emily was on a roll about republicans and
how evil they are (never mind the bastard in the white house). she
introduced the song by talking about the fact that the republicans wouldn't
ratify the nuclear test-ban treaty.
johnny rotten--amy blows me away. this song is amazing. we really do need
to get a killer boot of her doing this!
philosophy of loss--this is the first time i'd ever heard emily do this one.
it's even more haunting than it is on the album.
wood song--finally!!! i finally get to hear this one live. excellent! it
was funny, amy had her guitar tuned to funky mix between wood song and
virginia woolf. emily stopped her in the middle of the first verse and they
started over.
one of the better indigo girls shows i've ever been to. it wasn't better
than the 3rd night at the beacon, but it came close. the audience was
definitely into this show. the girls pulled our energy onto the stage and
delivered an incredible performance.
i'm a little sad that this was the last show i'm going to see for another
three weeks, but what a way to end it!!!!
that's the review...
cheers,
l'sly
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 15 oct 1999 22:17:45 -0700
reply-to: dawn <venussage@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: dawn <venussage@yahoo.com>
subject: hello everyone!
mime-version: 1.0
content-type: text/plain; charset=us-ascii
okay, i'm having a duh moment. i hope that i have not
sent everyone a messed up e-mail already. i'm trying
again to post this to the list. sorry, guys. :)
____________________________________________________
i've been lurking for almost a week now, trying to see
what the personality of the board is.
i first got turned onto the girls after my first
girlfriend (5 years) dumped me. i found a lot of
comfort in their songs, and my passion has just grown
from there.
my girlfriend thinks i'm nuts and obsessive, but heck,
why not? i have to extend all this energy somewhere,
right?
i really enjoying hearing everyone's take on the
songs. it is nice to get some perspective and
different points of view.
speaking of "view"....i am just glad the girls are
getting a little tv time. we all know how wonderful
they are, but there is a huge populace of ignorance
out there. sad, but true. :)
i haven't seen the girls since 1997 in denver. i live
in dallas, and it seems like the girls never make it
out here. i know it's not the coolest place, but i'm
here, so they should come more often.
anyway, enough rambling. i just wanted to say hello
to everyone. it's nice to be among friends.
dawn
=====
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 02:53:13 -0500
reply-to: greg flamer <gflame@megsinet.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: greg flamer <gflame@megsinet.net>
subject: hey chicago--guess who's coming!!!
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
ok, now relax, chill, calm down. great news for us in chicago!! just
happened to be doing a little browsing around this evening (morning?).
looked up ig and chicago on all concert sites. no luck.....until i hit the
ticketbastard site. just so happens they have an ig show listed!!!!! i am
doing cartwheels. ok so you want the scoop.
indigo girls
sunday december 5, 1999
8 pm
chicago theater
175 n state
chicago il
tix go on sale october 23 at 12 pm
i did not see this date anywhere else which means it must be brand spanking
new. i am elated. see y'all in the front row!
greg
!@#$%^&*!@#$%^&*!@#$%^&*!@#$%^&*!@#$%^&^%$#*()*(^$)
$ gflame@megsinet.net !
# greg m. flamer %
$ 417 w roscoe st #405 *
& chicago, il 60657 &
# "...acts that change a life or the world *
! usually happen way out on thin ice." &
@#$%^&*()+!@#$%^&*()+!@#$%^&*()!@#$%^&*()+=!@#%^&%#
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 01:49:45 pdt
reply-to: lia kueck <aeig2317@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lia kueck <aeig2317@hotmail.com>
subject: re: hey chicago--guess who's coming!!!
mime-version: 1.0
content-type: text/plain; format=flowed
let me be the first to say
yeeeessssss!!!!!
oh sweet jesus thank you....the girls are coming to chicago!!!!
for all of you that have already been to ig shows and gotten good seats,
what's the best way to order...phone? computer? go to an outlet?
money is no object to me, do i have any chance of getting first row?
i am one happy girl
lia
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 05:52:42 -0400
reply-to: heather solimini <hxs171@psu.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: heather solimini <hxs171@psu.edu>
subject: tussey mtn. 7/10/98
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
hey y'all,
i've just resubscribed to the list after nearly two years. good to be
back. :)
with that said, i'm jumping right back in with two questions:
#1. i have a very good bootleg of the 7/10/98 concert at tussey mtn. in
boalsburg, pa. i've been meaning to offer it up for trading for a very
long time, but haven't been on the list, nor have i had much time for
trading. so, my question is -- is this nothing new? has everyone
already gotten a chance at another version of this concert? does anyone
care? just checkin'. :)
#2. i'm also looking for a particular bootleg. i can't remember the
exact date, but it ocurred in april of 1998 at dickinson college in pa.
right before i last left the list, i remember this one being traded.
does anyone have it, preferably a close-to-first-generation-copy? i
will love you forever.
lurve,
feather
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 09:25:56 edt
reply-to: hoodoo4730@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: hoodoo4730@aol.com
subject: re: the view again
x-to: sneakyjean@yahoo.com
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i appreciate everyone's re-views, but was unable to see it myself. it seems
as if rosie's blip of an intro and one song show had a great deal more
detailed commentary on the list...someone please inform those of us who did
not see the show what (if any) other questions were asked and which song was
performed (pt?).
thanks, y'all.
angie
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 10:01:32 edt
reply-to: memememi@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: memememi@aol.com
subject: re: the view again
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 99-10-16 09:56:20 edt, hoodoo4730@aol.com writes:
> someone please inform those of us who did
> not see the show what (if any) other questions were asked and which song
was
> performed (pt?).
this is the information that was posted on the view's website, as a recap of
the show yesterday.
indigo girls
cd: indigo girls come on now social
indigo girls are emily saliers and amy ray. they write their songs
separately, but both say that most of their lyrics are autobiographical and
come from self-experience. emily says that both the music and the message are
important to her. she takes a lot of time when writing, hoping that the music
and lyrics fit each other. amy feels the same way, adding that she uses music
to get across a lighthearted feel to what she's trying to say. their new
song, "peace tonight," which they performed on the show, is a feel-good song
about creating peace in the world just by being good to each other.
=)
lisa
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 10:27:28 edt
reply-to: shedyskin@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: shedyskin@aol.com
subject: help me chicago!!!!
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i'm so happy and disappointed at the same time. happy is because the girls
finally hit chicago!! disappointed is on the ticket sale day i'll be driving
to minnipolis for a wedding! i was wondering, any kind friend from chicago
can get me a good ticket?? i don't know anyone that likes ig anyway so i have
to go alone! :-( pleeeeeese???
peace
dorothy
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 11:21:15 edt
reply-to: lyndsay agans <eccemus@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lyndsay agans <eccemus@hotmail.com>
subject: asbury park--talk to the girls during the show.... :o)
mime-version: 1.0
content-type: text/plain; format=flowed
okay, so....first things first....
my girlfriend and i drove to nj from md and waited outside the paramount
theatre starting at 2:30, so we could be front row. the crowd control person
came out to ask the 5 of us who had been sitting out there in proper order
if we felt the need to start a list or somehting--to be fair. in the way of
indigo peace, we all felt no, not us, not indigo fans, it's cool. which
would have been fine if not for the 6 or so people who cut up to the front
of the line in front of a great deal of people who had been waiting hours in
the cold. so, me being who i am, go to talk to them. one particular male
individual was very rude and very obnoxious, and i was just trying to show
him how unfair his actions were. anyway...
asbury park was really an odd choice for a venue to play. as we drove out
last night from the show, our main concern was to get the hell out of asbury
park. i'm sure at one time it thrived, but not in the last decade!
okay getting to the good part!!
the show was damn great...i loved the set-list. if the crowd weren't so
rude, it would have been one of the best. they shook it up...etc. my
personal favorite part was when they stopped to sing happy birthday to me.
my girlfriend had a sign that said please sing happy birthday to lyndsay and
amy saw it and winked at us. it was very awesome. and then they were
talking to me in the middle of the concert. i could not believe it. so,
after the show they really weren't gonna sign, but emily told me happy
birthday again and signed my guitar. pretty awesome.
plus, i got a set-list and pick. not a bad birthday at all.
yay! another thing i have to say is that we met some awesome people in
line...it's all about 1st row! cool.
take care y'all...
-lyndsay
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 11:47:43 edt
reply-to: jennie church <jennieum@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jennie church <jennieum@hotmail.com>
subject: new tour dates
mime-version: 1.0
content-type: text/plain; format=flowed
yahoo! there are a whole bunch of new midwestern tour dates on the official
site including 12/10 in ann arbor at the power center (about a 5 minute walk
from my dorm room). if anyone has any idea when the onsale dates for these
shows might be please post it or contact me. yay!!!
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 11:54:09 -0400
reply-to: susan brill <susan.brill@yale.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: susan brill <susan.brill@yale.edu>
subject: re: darty commentary/sister (again)
in-reply-to: <3.0.6.32.19991015175447.007a7b00@acs-pop.bu.edu>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
>sister. regarding "milkcow and a mess". i think people are looking too
>much at their gateway boxes. ig are bizarre lyricists sometimes (emily
>especially on this album), but dairy farming is just too much of a buzzkill
>given the context. has anyone that's seen this live noticed what emily was
>singing?
i've been right up front for a few concerts now (i feel so blessed!) and i
looked every time. it always looked like milk cow and a mess to me.
-s.
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 12:01:59 edt
reply-to: shannon mast <shannonmast@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: shannon mast <shannonmast@hotmail.com>
subject: mister limes/miss herd list/why hotmail sucks
mime-version: 1.0
content-type: text/plain; format=flowed
okay, so--since hotmail is crappy, it's been stealing messages from me and
sometimes deciding to send them to me at a later date, and sometimes just
eating them. thus, if anyone else wants the miss herd lyrics list, please
email me at shannonmast@valkyrie.net, not this hotmail account!!! :) and i
apologize to anyone who may have sent a request and not gotten a response.
shannon
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 12:21:00 -0400
reply-to: mark anthony donajkowski <madonajk@alpha.delta.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: mark anthony donajkowski <madonajk@alpha.delta.edu>
subject: the new girls site
mime-version: 1.0
content-type: text/plain; charset=us-ascii
dontk now if anyones been here
http://www.epiccenter.com/epiccenter/indigogirls/index.html
and u may have to go to just the epiccenter.com first since i couildnt
access it with the url but they have a new screeen saver and wall paper
and other things its all for the new cd
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 12:26:15 -0400
reply-to: susan brill <susan.brill@yale.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: susan brill <susan.brill@yale.edu>
subject: asbury park and don't yell galileo campaign
in-reply-to: <19991016152115.54944.qmail@hotmail.com>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey y'all,
i really enjoyed the asbury park show! the girls really seemed to love
watching lyndsay (happy bday, btw) and the big group of friends all around
dancing away in the front row. tons of energy! they also said they liked
the signs some had made with nice messages.
there were a few minor crowd bummer incidents - the old galileo yelling
thing came back, of course. one was during the end of oziline "what a
blessed (galileo!!) sky".. amy's face sort of fell in resignation to the
inevitability of it all. soon after that a bunch of folks were yelling
galileo while the girls were getting ready to sing soon be to nothing. this
started a small exchange where emily said, "you know we have a new record
out and we want to play some of the new songs". the audience person said,
"we love you anyway", and amy said, "and we love you even though you want
to hear galileo".
i was sorta thinking - maybe a few of you outgoing list folks who are
making signs could include one facing the audience that says something like
"don't yell galileo - they play it at the end!" if you flashed that around
to the girls i think they'd get a big kick out of it.
-sue
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 12:43:26 -0400
reply-to: susan brill <susan.brill@yale.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: susan brill <susan.brill@yale.edu>
subject: blair cunningham rocks!
in-reply-to: <19991016152115.54944.qmail@hotmail.com>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
i just gotta say i _love_ this new band - they are all adding great new
touches to the songs. blair cunningham is _it_! he is awesome. i can't say
enough great things about what he adds to the shows. i have just loved
these ny area shows - the new songs are awesome and blair just pumps it up
in songs like go, trouble, sister (in the chorus), compromise - wow that
song is great with the clarity and punch of blair's drums in concert. i
miss it when i listen to the cd version now (more muffled). he also does
amazing things with the older songs too - shed your skin is just cooler
than it has ever been, and that's saying a lot!
y'all who are getting ready for concerts in the next weeks are in for a
great time 'cause this band is awesome and it keeps getting better.
somebody make a sign about the band for an upcoming show.
and don't yell galileo! (i know, it's not the list...)
-sue
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 09:48:07 pdt
reply-to: lia kueck <aeig2317@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lia kueck <aeig2317@hotmail.com>
subject: holy cow...midwest!!
mime-version: 1.0
content-type: text/plain; format=flowed
ok, please someone...anyone, tell me any info about when this stuff goes on
sale....if i pull it off (ahd drop out of school), i could see seven
concerts in 8 days. horray for the midwest!!!
lia
happy happy happy girl
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 13:07:18 edt
reply-to: jennie church <jennieum@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jennie church <jennieum@hotmail.com>
subject: wallofsound article
mime-version: 1.0
content-type: text/plain; format=flowed
wow, two posts in one day...
there's a new article at www.wallofsound.com about the girls. it talks
about how they decided against using malcolm burn as a producer for cons.
pretty interesting.
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 12:32:31 -0500
reply-to: pamela.weller-dengel@mankato.msus.edu
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: pamela weller-dengel <pamela.weller-dengel@mankato.msus.edu>
subject: reply: holy cow...midwest!!
x-to: lia kueck <aeig2317@hotmail.com>
in-reply-to: <19991016164807.8072.qmail@hotmail.com>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
lia--
don't know if you are thinkin' about going to the eau claire concert on
the 3rd of dec, but i just called the "service center" (apparently they
will be selling the tickets-phone #715-836-3727) and was told that it
has not yet been decided when tickets will go on sale (i say this is
not an acceptable answer!), but that yes, tickets will be available to
the general public and will cost $27. what i don't know is whether or
not tickets can be charged over the phone (does not sound like
ticketmaster is involved at all)...my concert-goin' friend and i
decided we will just have to call them every day to get the scoop on
when tickets are going on sale! does anyone else know anything more on
this?
also, i just checked the northrup website (12/4 concert)and could not
come up with any mention of anything, maybe just too soon?
good luck--
pam
on sat, 16 oct 1999 09:48:07 pdt lia kueck <aeig2317@hotmail.com> wrote:
> ok, please someone...anyone, tell me any info about when this stuff goes on
> sale....if i pull it off (ahd drop out of school), i could see seven
> concerts in 8 days. horray for the midwest!!!
> lia
> happy happy happy girl
>
> ______________________________________________________
> get your private, free email at http://www.hotmail.com
>
> --
> please do not send long non-indigo girls-related forwards to the list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
----------------------
pamela weller-dengel
assistant director, career development center
minnesota state university, mankato
pamela.weller-dengel@mankato.msus.edu
"life consists not in holding good cards but
in playing those you hold well."
--josh billings
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 13:38:41 edt
reply-to: asilve6213@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: amy s <asilve6213@aol.com>
subject: columbus date
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
hi all,
i was just wondering if anybody had any more info on the columbus, oh date.
when the tix go on sale, etc. please let me know. i am so excited, i feel
like a little girl:)
~amy s.
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 12:01:06 -0700
reply-to: hawke2@email.msn.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: ryan blackhawke <hawke2@email.msn.com>
subject: re: mumia... n i g c
in-reply-to: <19991015215835.29767.qmail@hotmail.com>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
what kind of a society do we live in when peopple are organizing to demand
the execution of another? seems we haven't moved far beyond the
cannibalistic neanderthals.
ryan
> -----original message-----
> at the same time, by running out the widow-fighting-by-herself myth,
> bissinger seeks to hide the role of rick costello of the
> fraternal order of
> police. unfortunately for the official myth, costello has a big
> mouth and is
> constantly bragging about the f.o.p. raising the money and organizing the
> campaign for jamal's execution (operated through a pennsylvania dummy
> corporation, "justice for p/o daniel faulkner, inc."). nor does bissinger
> tell his readers about the chief cheerleader role of michael
> smerconish. on
> april 23, smerconish organized 800 people to come to a $100 a plate dinner
> at philadelphia's elite union league club to raise money to campaign for
> jamal's execution.
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 12:45:18 -0700
reply-to: cynthia crecca <ccrecca@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: cynthia crecca <ccrecca@yahoo.com>
subject: asbury park (a defense) and ig
mime-version: 1.0
content-type: text/plain; charset=us-ascii
i saw the asbury park show last night and i think it
rivals the state theater (nj) show in 1992 (?) as the
best ig show i have seen.
yes, the show was in asbury park which is one of nj's
poorest cities and a special needs district but it is
also a city of great musical historical significance
(for all you bruce springsteen fans). though the
paramount theater was run-down but in the restoration
process (that ceiling and walls are stucco, the exit
signs on the first floor are stained glass and the
chandliers are antiques) the acoustics were amazing,
the setting was intimate and the ambience was great.
what did that place seat---2000 people maybe? beats
msg for an ig concert any day...i am making it a point
to see any band i like there and am taking my husband
to see an opera there next month but i digress...
there is a movement to restore asbury park and bring
it back to the thriving seaside community it once was.
the nightlife is coming back to life largely in part
to the numerous gay and lesbian clubs and bars.
some think the best chance for a revitialization of
this seaside town is the gay and lesbian community.
i don't know if ig are aware of the socio-cultural
dynamics of the city but i think it is cool they
played there anyway. (too bad the sone pony doesn't
do concerts anymore :-( )
on a personal note, i think ig looked like they
enjoyed the show. they were much looser than the
apperance i saw at the beacon earlier in the week.
again, it ranks as one of my top 2 fav. ig
performances and if anyone happened to boot the show i
would be interesting in talking to you (and perhaps
naming my first born after you in exchange for a
tape). :-)
sorry if this ranted a bit...
cindy
from nj (obviously)
p.s. for future shows idea: bring a sign that says
"play new stuff" or "cons rocks". show ig some fans
want to hear the new stuff!
=====
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 16:53:24 -0400
reply-to: mark anthony donajkowski <madonajk@alpha.delta.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: mark anthony donajkowski <madonajk@alpha.delta.edu>
subject: re: 10/11 nyc show review
x-to: lance longwell <longwell_ls@hotmail.com>
in-reply-to: <pine.osf.3.95.991012085757.20238a-100000@alpha.delta.edu>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
so did anyone boot this? i never got a response
on tue, 12 oct 1999, mark anthony donajkowski wrote:
>
> does anyone have a copy of this
>
> on tue, 12 oct 1999, lance longwell wrote:
>
> > i know somebody briefly posted a review, but i thought i would throw in with
> > a little more. full setlist was (in order):
> >
> > go (with joan osborne)
> > peace tonight (with joan osborne)
> > tried to be true
> > get out the map
> > skooter boyz
> > soon to be nothing
> > ozilline
> > cold beer and remote control
> > shed your skin
> > sister
> > least complicated
> > johnny rotten (amy on mandolin only)...this rocked!!!
> > compromise
> > power of two
> > faye tucker
> > trouble (with joan osborne)
> > shame on you (with joan osborne)
> >
> > encore:
> > ghost
> > gone again
> > galileo
> >
> > for what it's worth, the band has improved immensely in the last few weeks.
> > now that reynolds is gone (i love him, but he didn't work with ig), blake
> > has brought some real leadership to the rythem section! rythem is tight,
> > full, and funky...just the way it should be. yesterday was his birthday so
> > they brought him out a cake! let me tell ya, emily can sure belt "happy
> > birthday".
> >
> > opening act: butchies. after having seen mrs. fun and rosie polandzani, i
> > wasn't too thrilled about another ig opening act. however, the butchies
> > were the best!!!! without a doubt, the best opening act i've seen for ig
> > yet! amy came out with her cute little red tamborine and did shooting star
> > with them.
> >
> > i noticed that ig had brought along a big "truck" (bout 4 feet high, 4 feet
> > deep and about 7 feet long) mobile recording unit. it looked like it was 16
> > decks from were i was sitting. they were recording that show and intended
> > to get some quality. does anyone know if they've been recording the other
> > shows with that kind of power? i'd never seen them do that before.
> >
> > add, whoever was in the mezzanine section with the camcorder and
> > tripod......i want a copy of the video boot!!!! (don't think we didn't see
> > you!)
> >
> > anyway, that's night 1 in a nutshell. 4 more ig shows to go this week!!!!!!
> >
> > l'sly
> >
> >
> > ______________________________________________________
> > get your private, free email at http://www.hotmail.com
> >
> > --
> > do not quote other peoples' entire messages when replying to the list.
> > indigo girls faq and indigo girls mailing list faq:
> > http://www.fl.net.au/~sherlyn/ig
> >
>
>
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 18:16:09 edt
reply-to: tattoo1981@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristin tat <tattoo1981@aol.com>
subject: re: backing vocals, misheard lyrics and ig on radio
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
ok i have to comment that i like the changes in the cons album. seriously change is good and that is what ig did. the banjo and the country trang as well as amy rocking out was beneficial. i don't know about u but some of their earlier music kind of was stuck in a rut or lack of variation in tunes and this cons cd had variation. there was definit meaning in it. i loved the different instruments in it also added to the meaning
tat
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 18:27:58 edt
reply-to: tattoo1981@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristin tat <tattoo1981@aol.com>
subject: sigc: dream
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i have to say that i have been out of town for the whole week so the idea of coming out did not comeup. i did come out to a couple of people at school and i made a hemp choker that has pink triangles on it as well as a frog on a lilly pad. there is symbolism. until a little more than a week ago i had freedon rings, but those i lost. oh i wore i rainbow neckless on last monday.
i plan to comeout to my parents when i go home on thanks giving, if anything i need more time
back to ig. i had a 2 two dreams about them. one was that they showed up on my college campus and were talkative and i invited them on a tour of downtown, but i was a fraid to drive them insane so i left them alone. the other dream was they played this mini show like it was on the side of the road kind of wierd. anyway
tat
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 18:34:15 -0400
reply-to: mike reynolds <io20742@exploremaine.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: mike reynolds <io20742@exploremaine.com>
subject: re: hey chicago--guess who's coming!!!
x-to: greg flamer <gflame@megsinet.net>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
arrgh!
i'll be in chicago on 12/7...two days after the ig.
oh well - dartmouth was awesome...
peace -
mike r.
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 18:41:09 edt
reply-to: tattoo1981@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristin tat <tattoo1981@aol.com>
subject: re: nigc: coming out
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
actually, i have the same question that shannon did as in does it really matter when u come out to people and is there a particular process that people go through/ email privately thanks
tat
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 19:02:38 edt
reply-to: tattoo1981@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristin tat <tattoo1981@aol.com>
subject: re: sister
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i have to say that i agree with the what was said about the song junkie girl, i was thinking maybe prostitution or maybe i am going off a cliff by saying that. but if it was not prostitution then what was it?
tat
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 14:50:06 pdt
reply-to: lia kueck <aeig2317@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lia kueck <aeig2317@hotmail.com>
subject: milwaukee
mime-version: 1.0
content-type: text/plain; format=flowed
hey everybody,
i'm out of my mind with all these midwest dates!!!
aaanyway....milwaukee tickets go on sale oct 25th (i don't know what time)
and the number is (414)224-3000. anyone going to be roadtripping to these
shows? they're all within 3 hours of my hometown...so i'm going for broke.
peace and midwest love
lia
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 17:41:17 -0600
reply-to: kz123@worldnet.att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kz123@worldnet.att.net
subject: re: fwd: re: the view again
x-to: barbara bordner <barbinmn@webtv.net>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
you know, i kinda always liked old tom myself, although i always got the
feeling the guy was just going to crack entirely at some point.
i'd love to see them with charlie rose. he did the most wonderful
interview with michael stipe - it was quite cute. i thought mr. stipe was
flirting with him a bit. it was an excellent interview.
kc
barbara bordner wrote:
> from: barbinmn@webtv.net (barbara bordner)
>
> i look forward to the girls when they are on tv. that's too bad that
> they never made the late late show w tom snyder, because they could
> easily have filled up a whole hour. and tom snyder was one f the best
> interviewers in the business. and certainly
> a lot better than craig kilborn anyday. (that's coming from someone in
> the 18-35 age group btw if that makes any difference.) he had so much
> more depth.
>
> and it didn't seem to matter to him, what sexuality a person was.
> unlike the women on the view.
>
> barb
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 17:48:50 -0600
reply-to: kz123@worldnet.att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kz123@worldnet.att.net
subject: re: nigc: coming out
x-to: tattoo1981@aol.com
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
just my two cents on coming out...
contact pflag - parents, friends and family of lesbians and gays. they are a really great group - i choke up when they march by at pride every year.
they have fantastic literature on coming out and the issues surrounding coming out. you never have to feel uncomfortable with the folks at pflag - they are working on behalf of people they
care about and they understand.
i especially recommend pflag to youth who are concerned about how their parents or guardians will react to the news.
they are listed in the phone book.
best,
kc
kristin tat wrote:
> actually, i have the same question that shannon did as in does it really matter when u come out to people and is there a particular process that people go through/ email privately thanks
> tat
>
> --
> please do not send long non-indigo girls-related forwards to the list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 16:54:30 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: re: nigc: coming out
mime-version: 1.0
content-type: text/plain; charset=us-ascii
pflag also has a national website... i referred my mother to it and she
told me it was very helpful.
www.pflag.org
~jean
--- kz123@worldnet.att.net wrote:
> just my two cents on coming out...
> contact pflag - parents, friends and family of lesbians and gays.
> they are a really great group - i choke up when they march by at
> pride every year.
>
> they have fantastic literature on coming out and the issues
> surrounding coming out. you never have to feel uncomfortable with the
> folks at pflag - they are working on behalf of people they
> care about and they understand.
>
> i especially recommend pflag to youth who are concerned about how
> their parents or guardians will react to the news.
>
> they are listed in the phone book.
>
> best,
> kc
>
>
> kristin tat wrote:
>
> > actually, i have the same question that shannon did as in does it
> really matter when u come out to people and is there a particular
> process that people go through/ email privately thanks
> > tat
> >
> > --
> > please do not send long non-indigo girls-related forwards to the
> list.
> > indigo girls faq and indigo girls mailing list faq:
> > http://www.fl.net.au/~sherlyn/ig
>
> --
> please do not send long non-indigo girls-related forwards to the
> list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 20:53:56 edt
reply-to: lindystar2@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lindystar2@aol.com
subject: re: new tour dates
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
can someone send me these new midwest dates? my computer isnt working right
tonight=(
casey
--
do not quote other peoples' entire messages when replying to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 21:17:11 -0500
reply-to: shannon donnally <smdonnally@students.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: shannon donnally <smdonnally@students.wisc.edu>
subject: the view and other random musings
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hi yall.
i have been so busy this semester that i have only read
all your cons comments sporadically and haven't posted
any of my thoughts. so just a couple random ones...
first the view:
i thought they had a better performance on rosie, and at
least they did get interviewed. while i agree that the
"couple" question was kindof silly, i really liked her
second question, which was something like "which is more
important, the music or the lyrics?"
cons in general:
i like the album a lot. i agree with some peoples gripings,
especially the ones about the lack of harmonies and that
sometimes it is too hard to hear the voices. in general,
though, i think it's very good.
i also agree with a lot of people that it seems to be an
especially strong cd for amy.....usually emily's songs
grab me right away and amy's have to grow on me more,
but most of the grab-me's this time were amy's.
i remember hearing that at some point amy had said that
this record would be more folk-oriented, and though it
didn't turn out to be true in the way which we might have
thought, it did in a way, especially with her songs. the
bluegrass-y feels of some of her songs is great.
faves from the new album: gone again, ozillene, philosophy
of loss, soon to be nothing
yay! can't wait til milwaukee!
shannon
--
do not quote other peoples' entire messages when replying to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 18:24:32 -0700
reply-to: the redheaded goddess <thatredheadedgirl@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: the redheaded goddess <thatredheadedgirl@yahoo.com>
subject: utah concert info
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hi all,
i just found out the utah concert info. finding it
out was like pulling teeth, about zero publicity.
anyway, here goes: the concert is at utah state
university in logan at the spectrum arena. tickets go
on sale monday october 18 at 9:00 a.m. tickets can be
purchased at the spectrum box office, or the taggert
student center info desk or can be charged by phone at
1-888-878-2831. prices are 21.25 for students, 27.50
for everyone else. students may buy two tickets at
that price and the tickets must be bought at the
taggert student center with a valid id. to charge by
phone you need a visa, mastercard, or discover card.
if you want to hear the recorded message call the
number above and press 4. don't ask me about
directions because i live in salt lake and don't know
my way around logan.
good luck,
diana
=====
___________________________________________________________
dreams unwind, love's a state of mind.
stevie nicks
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
do not quote other peoples' entire messages when replying to the list.
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 22:42:11 edt
reply-to: lisa071573@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lisa r <lisa071573@aol.com>
subject: some igc
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
personally, i never liked tom synder...that man drove me nuts laughing at his
own jokes that were not funny...anyway...melissa is supposed to be on the
list tonight on vh1 at 11:00, i think - always best to check your local
listings...for any tori fans, tori is supposed to be on charlie rose on
monday and rosie o on thursday...i'm also still looking for the 4/24/99 ig
boot (i think i've got the date right now)...someone had contacted me but i
think they've forgotten.
~lisa
"let's start a cult, of people just like us...sign me up with a three-way
kiss." ~barbarakessler
--
do not quote other peoples' entire messages when replying to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 21:37:05 -0800
reply-to: allison fraiberg <edgy@linkline.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: allison fraiberg <edgy@linkline.com>
subject: looking for i-girl (nigc)
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
apologies for the nigc, but i was trying to track down the infamous i-girl.
iggy, if you are still on the list, can you email me?
cheers,
allison
edgy@linkline.com
--
do not quote other peoples' entire messages when replying to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 00:36:08 edt
reply-to: gitroop@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "<erin tripp>" <gitroop@aol.com>
subject: ig in people magazine
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
hey all... emily and amy are in the newest copy of people (oct. 25, 99)
magazine. it's a short article, about a column, but they named cons "album
of the week". there is also a nice 1/2 page picture of them, jamming on
their electrics...
thank you karen!!! :)
peace-
trooper
--
do not quote other peoples' entire messages when replying to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 01:47:16 edt
reply-to: lindystar2@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lindystar2@aol.com
subject: re: new tour dates
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
oh my god! three times!! they're coming to indy three times!!! i am so
excited!!!! ahhh! ok, im breathing i swear=) whooo-hoo!!
casey
--
do not quote other peoples' entire messages when replying to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sat, 16 oct 1999 22:32:16 -0500
reply-to: barbara bordner <barbinmn@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: barbara bordner <barbinmn@webtv.net>
subject: re: asbury park (a defense) and ig
in-reply-to: cynthia crecca <ccrecca@yahoo.com>'s message of sat, 16 oct 1999
12:45:18 -0700
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
here's a thought....does anyone consider that
if asbury park is one of <<the poorest places in new jersey>> than
maybe it wasn't such a bad thing. now maybe more people will be working
to end the poverty there.
peace,
barb
--
do not quote other peoples' entire messages when replying to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 15:41:30 -0500
reply-to: barbara bordner <barbinmn@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: barbara bordner <barbinmn@webtv.net>
subject: re: sigc/ about tom snyder though
in-reply-to: lisa r <lisa071573@aol.com>'s message of sat, 16 oct 1999
22:42:11 edt
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
what's wrong with laughing at your own jokes,
i thought his laughter was rather nice, all right
so he's no bill cosby or george carlin, but his show was far better than
the late night trash that's on now. it's alllllllll party stuff with no
substance. that's fine for those of us who like to whoop it up at that
time, but at that time, i like to watch tv that quietly provides food
for thought.
lisa071573 writes <<that man drove me nuts laughing at his own jokes
that were not funny.>>,
barb
--
do not quote other peoples' entire messages when replying to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 14:06:26 -0700
reply-to: mocagu <mocagu@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: mocagu <mocagu@yahoo.com>
subject: yahoo account (nigc)
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hi:
does anybody knows how to resign a yahoo account?
any help would be very appreciated!!!!!
take care,
mocagu
=====
"the most wasted day of all is that in which we have not laughed"
sébastien-roch nicolas de chamfort
"what we call human nature in actuality is human habit"
jewel
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
do not quote other peoples' entire messages when replying to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 13:07:43 pdt
reply-to: karen murphy <murphyslaw77@netscape.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: karen murphy <murphyslaw77@netscape.net>
subject: ???
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 8bit
no list mail... what's going on?
is anna hidalgo responsible for this???
=0) -k
____________________________________________________________________
get your own free, personal netscape webmail account today at http://webmail.netscape.com.
--
do not quote other peoples' entire messages when replying to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 16:56:05 -0600
reply-to: "amy m." <indigrrl@selway.umt.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "amy m." <indigrrl@selway.umt.edu>
subject: the view
x-to: iglist2 <indigogirls@egroups.com>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
man, i thought it was bad when that blonde bubblehead that they finally
got rid of interviewed them last time they were on the view. sorry, i
really don't mean to offend any view fans, but i can't stand
that show and i wondered last time they were on it, "why, the view?" and i
found myself wondering that yet again. i'd much rather have barbara
walters ask them some thought-provoking questions than have the current
young, supposedly hip one asking them brainless questions. argh...
just my humble opinion,
amy m.
&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&
"we are not empty-headed celebrities."
-the goddess, amy ray
"women together is a powerful thing, especially when you join it with
music."
-the goddess, emily saliers
**********************************************************************************
"to be nobody but myself-in a world which is doing its best, night and
day, to make you everybody else-means to fight the hardest battle which
any human being can fight, and never stop fighting."
-e.e. cummings
**************************************************************************************
--
do not quote other peoples' entire messages when replying to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 20:09:02 edt
reply-to: tattoo1981@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristin tat <tattoo1981@aol.com>
subject: nigc: boots
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i just remembered that somone vollunteered to make boots for me and it was not just beccie, but someone else. would that person email me if possible.
tat
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 20:10:39 edt
reply-to: tattoo1981@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristin tat <tattoo1981@aol.com>
subject: the view
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
ok i can comprehend why the interviewer asked if they were a couple. i have a feeling that i would also becuase people can be obsessed especially when it has to do with gay stuff if they are not around it that much and don't understand it that much.
tat
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 20:34:37 edt
reply-to: wishmonstr@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "e. moranian bolles" <wishmonstr@aol.com>
subject: i'm a dork (semi-igc)
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
hey y'all ~
i'm writing to you from atlanta, ga. i'll supply a detailed report of my
yet to be completed mecca on tuesday, but for the moment i'll leave you with
the following appetizer....
my father and i went to emily's watershed restaurant. he paid while i ran to
the ladies room, and then when i met him outside and got in the car, he said,
"they were selling michelle malone cds by the register." so i said, "stop
the car." (we hadn't gone too far), and got out and went back in. i buy the
cd, listen to it... blah blah blah.
so like 24 hours pass.
and i'm thinking, isn't it funny her name is on the cover twice? and that
one time it's really big, slightly illegible, and at a weird angle. and
wasn't it odd how it didn't come in plastic wrap...
*click*
yes my friends -- i bought an autographed copy and didn't notice.
later ~
elizabeth
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 10:10:03 +1000
reply-to: sherlyn koo <sherlyn@fl.net.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sherlyn koo <sherlyn@fl.net.au>
subject: fw: re: pictures of ig
x-cc: joeshenk@yahoo.com
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
this message was sent to the news-only list but is more
appropriate for here instead... please direct your
replies to the original sender at joeshenk@yahoo.com,
not to me, thanks...
-sherlyn
---begin forwarded message---
>date: fri, 15 oct 1999 20:02:30 -0700 (pdt)
>from: "joe p. shenk" <joeshenk@yahoo.com>
>subject: re: [ig-news] pictures of ig
>
> hi , all .
>
> i was just wondering , for those who saw both ig tv appearances this
week , whether the rosie
>o'donnell one was better than the the view one ... i accidentally missed
the rosie one . while i
>haven't been able to closely keep up with indigo girls stuff ( to be able
to compare well ) , i
>was a bit dissappointed by their interview / performance on the view .
any comments ?
>
> take care .
>
> --joe
>
>=====
>joeshenk@yahoo.com
>
>my home page (currently on kosovo ,etc.) :
>
>http://www.geocities.com/capitolhill/congress/8420
>__________________________________________________
>do you yahoo!?
>bid and sell for free at http://auctions.yahoo.com
>
>
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 10:34:50 +1000
reply-to: sherlyn koo <sherlyn@fl.net.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sherlyn koo <sherlyn@fl.net.au>
subject: wall of sound article
x-to: ig-news@smoe.org
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
here's the wall of sound article that jennie mentioned...
-sherlyn
---begin forwarded article---
october 15, 1999
indigo girls' 'tale of two producers'
indigo girls' new album, come on now social, could just as easily
have been titled "a tale of two producers," with a happy ending
to a troublesome situation.
the georgia duo started working on the album in london with
sinead o'connor sideman john reynolds, who the indigos met during
the 1998 lilith fair tour. they then returned to the u.s. to
record with malcolm burn, which is where things got a little,
well, anti-social.
"he really is brilliant," indigo girl amy ray says of burn, who's
still credited and plays on some of the album's tracks. "it's just
that he wants to do things a certain way and he won't bend at all,
and i just can't work in an environment like that. i have to work
in an environment where everybody bends. i do like him; it just
wasn't the right experience."
burn wound up making a valuable contribution to the album,
however. "he did force us to have confidence in our own vision,"
ray says. "i think what it helped us do was figure out that, well,
we want to grow but we don't necessarily have to put it into
someone else's hands in order to do that. we have enough
confidence and experience to grow on our own, to say, 'this is how
we are. this is how we work.' we don't want to have a negative
experience making a record."
the indigos re-recorded and finished most of come on now social
with reynolds, while "gone again" was recorded in woodstock, n.y.,
with drummer jerry marotta and band members garth hudson and rick
anko. sheryl crow contributed background vocals to that song as
well.
"it was kind of a disparate experience, but in the end we kept it
together," ray says. "i think the fact that we had to keep changing
horses in the middle of the stream and all this stuff was probably
a hard thing but a good thing in the end, 'cause it forced us to
examine and re-examine over and over again our approaches to the
songs, which i think made them all better."
-gary graff
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 10:47:56 +1000
reply-to: sherlyn koo <sherlyn@fl.net.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sherlyn koo <sherlyn@fl.net.au>
subject: "the view" on australian cable
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
could any australians out there who have cable please
enlighten me as to when/which channel "the view" is on?
in particular, has the one with the girls on it already
been aired? (i don't have cable but i can probably
persuade someone to tape it for me...)
thanks,
sherlyn
=-= sherlyn koo - sherlyn@fl.net.au =-=-=-=-=-=-= [sydney, australia]
"raise your hands, raise your hands high,
don't take a seat, don't stand aside this time,
don't assume anything, just go go go" - indigo girls
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 17:57:44 -0700
reply-to: alice jensen <alicejensen@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: alice jensen <alicejensen@yahoo.com>
subject: my prayers are answered.
mime-version: 1.0
content-type: text/plain; charset=us-ascii
i just have to say i am so excited the girls are
coming to st. louis. right around my birthday, i
could not ask for a better present. just wanted to
share my excitment thanks alice
=====
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 22:08:46 -0400
reply-to: mike reynolds <io20742@exploremaine.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: mike reynolds <io20742@exploremaine.com>
subject: ani webcast - now!!!
x-cc: baigls <baigls@world.std.com>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
with video - i'm not recording it as it is media player and have no way to
get a good audio (meaning no digital -> analog - > digital loss)
she's supposed to be doing a few new tunes from "to the teeth" - hopefully
she will play some grat stuff or they will archive it.
mike r.
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 19:40:13 -0700
reply-to: amy teplow <amtep@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: amy teplow <amtep@yahoo.com>
subject: sigc- ani d in austin-great show!
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hi folks!
i just had to say that i went to the ani concert here in austin friday
night, and it was one of the greatest shows i've ever seen. good combo
of old and new songs, lots of story telling and interaction with the
audience.
igc- they were passing out flyers for another show at the backyard
later this month. who else but our wonderful ig! after reading
everybody's concert reviews i'm even more excited than i was before. i
can't wait to see the girls! is anyone else gonna be at the wed night
show here in austin at the backyard? just wondering.
amy
=====
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 20:00:47 pdt
reply-to: diane wong <arle@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: diane wong <arle@hotmail.com>
subject: featured album on xpn.org
mime-version: 1.0
content-type: text/plain; format=flowed
an unauthorized reproduction of the featured album of the week on xpn. org
(a radio station out of philly, harrisburg, and baltimore; forgive me, if
neil already posted this):
http://xpn.org/sections/featured_album_current/featured_album_current.html
indigo girls, come on now social
review by bruce warren, xpn programming director and world cafe producer
over a ten-year period of inspired recordings, amy ray and emily saliers
have created an instantly recognizable sound and a singular place in
american music.
come on now social, which features many guests including sheryl crow, joan
osborne, and me'shell ndegeocello, is as bold, reflective, original, and
introspective as the work that made the indigo girls famous. faithfully
committed to "life issues," such as women's rights, protection of the
environment, the rights of indigenous people, and gun control, the indigo
girls continue to speak out on the new album. addressing the inhumanities of
the death penalty on "faye tucker," amy and emily tell the story of the
first woman to be executed in the state of texas since the civil war.
come on now social showcases a wonderful new collection of music from two of
america's most beloved singer/songwriters. as love songs and battle cries
intertwine with social commentary, old and new fans alike will march to the
beat of the indigo girls.
______________________________________________________
get your private, free email at http://www.hotmail.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 14:11:29 +1000
reply-to: sherlyn koo <sherlyn@fl.net.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sherlyn koo <sherlyn@fl.net.au>
subject: fw: review of cons in people magazine
x-to: ig-news@smoe.org
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
this was posted to the newsgroup - this is the people
review that erin mentioned...
-sherlyn
---begin forwarded message---
from: "laura j turner" <ljturner@prodigy.net>
subject: review of cons in people magazine
date: fri, 15 oct 1999 20:02:40 -0400
reviewed by steve dougherty
they may not pack the cultural jolt the electrified dylan once did, but it
is still something of a shock to find a pair of dyed-in-the-flannel folkies
like the indigos blasting away on plugged-in guitars. the grammy-winning
folk duo of amy ray and emily saliers has been putting out amped-up albums
for a few years now, but they've never before rocked out as smartly as they
do on "go," the sinewy, reverberating opening track of this, their seventh
major label release. here they present the song's call to neo-feminist
action ("don't take a seat/don't stand aside/ this time don't assume
anything") as the kind of brainy power ballad that their athens, ga. ,
neighbor, r.e.m.'s michale stipe, might sing. other candidates for radio
play include "trouble", propelled by an updated bo diddley beat, and "peace
tonight," a brightly wrought mid-tempo rocker that showcases the girl's
harmonies in a sparkling pop setting. revered by fans for their lovely
vocals and topical, passionate songs, they've also been knocked as overly
earnest. dispersed among tunes like the country rocker "cold beer and remote
control" and the harder "compromise" are more traditional, country flavored
acoustic ballads that shine. closing the album with an old timey-
irish-appalachian reel, the girl's show they've come a long, long, way baby,
with an eerie industrial hidden track. bottom line: colorful outsiders shoot
for pop's mainstream.
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: sun, 17 oct 1999 21:08:19 -0700
reply-to: shannon curnutte <shannonc@oregon.uoregon.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: shannon curnutte <shannonc@oregon.uoregon.edu>
subject: re: ani webcast - now!!!
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
where???? please post a url with info like this!
mike reynolds wrote:
>
> with video - i'm not recording it as it is media player and have no way to
> get a good audio (meaning no digital -> analog - > digital loss)
>
> she's supposed to be doing a few new tunes from "to the teeth" - hopefully
> she will play some grat stuff or they will archive it.
>
> mike r.
>
> --
> for information about the news-only version of this list send
> this command to majordomo@smoe.org: info ig-news
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
--
shannon curnutte
shannonc@oregon.uoregon.edu
"i am certain of nothing but the holiness of the heart's
affections and the truth of imagination" -rilke
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 06:55:19 edt
reply-to: rgcs1123@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "(rena shear)" <rgcs1123@aol.com>
subject: amy's mandolin song
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
the concert at umass mullins center was excellent!
no one has posted a review yet and if no one does soon, i will, but for now,
does anyone who might have gotten a hold of a set list know the name of amy's
solo mandolin song? the one that you can hear the beginnings of on the cd
before "compromise"?
thanks
rena
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 12:59:15 +0100
reply-to: marion_o'sullivan@health.irlgov.ie
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: marion_o'sullivan@health.irlgov.ie
subject: amy taking voice lessons from ferron?
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hi all.
anybody else think that amy sounds exactly like ferron on the line from
faye tucker that goes "but nothing would move us"?
fare thee well, my bright stars.
marion (aka molly)
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 22:17:19 +1000
reply-to: anne maynes <n1910493@sparrow.qut.edu.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: anne maynes <n1910493@sparrow.qut.edu.au>
subject: attention aussies-brothersister
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hi everyone,
this is an email for all the australians on the list. the latest
queensland community gay paper brothersister has ig on its front page!!
it's the picture in the cd booklet with em peeking over amy's shoulder and
it looks so good being 40cm x 25cm and in colour. there's also an
accompanying article. if anyone wants a copy, email me back and i'll send
you one.
annie
"when the winds blow things round and back again,
what was once your pain wil be your home"
-emily saliers
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 09:44:00 -0400
reply-to: susan brill <susan.brill@yale.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: susan brill <susan.brill@yale.edu>
subject: re: amy's mandolin song
x-to: rgcs1123@aol.com
in-reply-to: <0.c8d9a7d9.253c5697@aol.com>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
that's an awesome song isn't it? really gets the crowd going. it is called
"johnny rotten".
i can't wait to hear about the concert!!
-s.
at 06:55 am 10/18/99 edt, (rena shear) wrote:
>the concert at umass mullins center was excellent!
>no one has posted a review yet and if no one does soon, i will, but for now,
>does anyone who might have gotten a hold of a set list know the name of amy's
>solo mandolin song? the one that you can hear the beginnings of on the cd
>before "compromise"?
>thanks
>rena
>
>--
>for information about the news-only version of this list send
> this command to majordomo@smoe.org: info ig-news
>indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 09:58:45 edt
reply-to: erinsuepoo@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "<erin carroll>" <erinsuepoo@aol.com>
subject: anyone speak of amherst?
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i don't know if i missed it somehow...but i didn't see anyone talk about the
amherst show. i thought it was great! the mix of songs was amazing...though
someone just had to yell for...yup, you guesed it galileo...during and
announcement (of all things) about the resource table! emily replied by
saying they would play it but to please just listen for a moment first. now
i found this not only rude but completely un called for seeing as someone
already had yelled out the same request and amy had addressed it by saying
they would be playing it...something like at the end...after they leave and
come back...don't be fooled... that just drives me insane.
now, i would like to appologize to the people behind me in section u as i had
to stand for a portion of the show because the people (actually two people in
the whole section) stood in front of me for the majority of the show. i sat
as much as i could because i didn't want to be rude...but i felt like i was
missing so much that i had to give in and stand for some.
so, anyone boot this? or dartmouth? i would be so interested!
thanks for reading.
love to all!
erin sue
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 10:51:30 edt
reply-to: indigo3000@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: indigo3000@aol.com
subject: ig list-meet austin
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
anyone interested in a list meet in austin? we're going to both shows...so
whoever is interested (for either night) let me know...
amy
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 14:55:15 gmt
reply-to: that loud girl <strange_fire66@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: that loud girl <strange_fire66@hotmail.com>
subject: re: ig in chicago
mime-version: 1.0
content-type: text/plain; format=flowed
chi-area listees-
i'm asking for a huge favor (hey, its my birthday! i can dream, can't
i?)--i am going to be in class on saturday when tickets go on sale. could
someone who is planning on getting tickets when they go on sale secure me an
extra one? i can get you the money ahead of time, and figure out all the
snazzy pertinent details.
love ya,
shelley
______________________________________________________
get your private, free email at http://www.hotmail.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 08:28:18 -0700
reply-to: diane gagnon <dispdmg@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: diane gagnon <dispdmg@yahoo.com>
subject: re: anyone speak of amherst?
mime-version: 1.0
content-type: text/plain; charset=us-ascii
the person who did the yelling was to the immediate right of me
and was extremely intoxicated and obnoxious throughout the whole
show. a lovely ending to an otherwise great night!
if anyone booted this i'd love to know - i'm not a boot person
normally but i was a bit distracted during the johnny rotten
segment and would like to hear it over again (and over and over
and over!)
and btw: if anyone caught the "happy birthday" towards the
beginning of the show, it was supposed to be for the 9 yr old
son of a friend of mine who we took to the show - the ticket
office was great about changing my two 15th row tickets to three
13th row center tickets! he was thrilled by the whole thing -
his first concert!
diane
--- "<erin carroll>" <erinsuepoo@aol.com> wrote:
> i don't know if i missed it somehow...but i didn't see anyone
> talk about the
> amherst show. i thought it was great! the mix of songs was
> amazing...though
> someone just had to yell for...yup, you guesed it
> galileo...during and
> announcement (of all things) about the resource table! emily
> replied by
> saying they would play it but to please just listen for a
> moment first. now
> i found this not only rude but completely un called for seeing
> as someone
> already had yelled out the same request and amy had addressed
> it by saying
> they would be playing it...something like at the end...after
> they leave and
> come back...don't be fooled... that just drives me insane.
>
> now, i would like to appologize to the people behind me in
> section u as i had
> to stand for a portion of the show because the people
> (actually two people in
> the whole section) stood in front of me for the majority of
> the show. i sat
> as much as i could because i didn't want to be rude...but i
> felt like i was
> missing so much that i had to give in and stand for some.
>
> so, anyone boot this? or dartmouth? i would be so
> interested!
> thanks for reading.
> love to all!
> erin sue
>
> --
> for information about the news-only version of this list send
> this command to majordomo@smoe.org: info ig-news
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
=====
diane gagnon
dispdmg@yahoo.com
any girl can be glamorous. all you have to do is stand
still and look stupid.
~hedy lamarr
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 10:04:14 -0400
reply-to: bean@neu.edu
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: elaine bean <bean@neu.edu>
organization: northeastern university, faculty senate office, 442 ry,
360 huntington ave., boston, ma 02115
subject: looking for mr. rotten boot
x-to: susan brill <susan.brill@yale.edu>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
>
> that's an awesome song isn't it? really gets the crowd going. it is called
> "johnny rotten".
>
----------------------------
i'd love to hear johnny rotten. - anyone get a good boot (from anyvenue
- i'm not particular) who's willing to share? please?
also, i was wondering as to the average age on this list - i know it's
not important but i need more mindless, unimportant trivia to occupy my
mind. seems like there are a lot of college students here - i'm aware
that this isn't an indication of the average age, but i'm just curious
as to what it is since it seems that the majority of posts are from
students. so, does anyone who maybe has some free time on his/her hands
want to poll everyone as to age and let us know? or someone who is
looking for an excuse to procrastinate from doing what they really
should be doing? (kinda like what i'm doing right now!)
elaine
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 11:36:53 edt
reply-to: kemejets@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kemejets@aol.com
subject: re: anyone speak of amherst?
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 10/18/99 10:01:11 am eastern daylight time,
erinsuepoo@aol.com writes:
<< now
i found this not only rude but completely un called for seeing as someone
already had yelled out the same request and amy had addressed it by saying
they would be playing it...something like at the end...after they leave and
come back...don't be fooled... that just drives me insane.
>>
actually... early in the show, amy only *thought* she was addressing someone
who yelled "galileo." my friend and i yelled "ghost" durring a moment of
dead silence (no, we were not interrupting a song or anyone talking.) amy
did that little hand on forehead trying to see who yelled type thing, and
said something like "don't worry, we're going to play that for the encore."
so lee and i got really really really excited... then during the encore we
realize that they thought we said galileo instead of ghost. oh well! but we
got to hear virginia woolf and 10,000 wars, so i was just about as happy as
can be. now i feel bad that they thought we were yelling "galileo"...
the whole concert was awesome! i never thought i'd hear !0,000 wars live,
and i was completely blown away by it. so good! i'm so sad that this is the
last ig show i'll see for a while :+(
~kristen
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 10:55:37 -0500
reply-to: sheryl jones <sljones1@facstaff.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sheryl jones <sljones1@facstaff.wisc.edu>
subject: nigc: legal services
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hi all. i hope you don't mind me coming here for advice. i'd like to know
if any gay couples out there have wills and/or living wills and how you
went about drawing them up. thanks.
----------------------------------------------------------
sheryl jones
sljones1@facstaff.wisc.edu
cooper seay page: http://www.geocities.com/felidae/cooper/cooper.htm
bootleg page: http://www.geocities.com/felidae/boots.htm
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 13:11:04 edt
reply-to: rgcs1123@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "(rena shear)" <rgcs1123@aol.com>
subject: umass concert
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i haven't had second row center seats in so long and my jaw is still on the
floor. i snuck an autofocus point and shoot camera in (turned off the flash)
but the photos came out too blurry:( oh well, i did tape it and it sounds
pretty good for my inexpensive aiwa recorder.
ph balance opened for them. they were interesting. i liked most of their
stuff. it was a mix of rap and what else? how would you describe the style
the woman was singing in?
the set list is:
go
trouble
scooter boys
get out the map
reunion -a nice surprise
cold beer and remote control
oziline
you and me of the 10,000 wars
johnny rotten-amy took us all by surprise with this one
closer to fine
compromise-incredible electric guitar energy by amy
peace tonight
this train-revised
power of two
faye tucker
least complicated
shame on you
*encore*
gone again
virginia woolf
galileo
the audience really got pulled into johnny rotten. i've never experienced
that before with a new song of theirs (especially an unrecorded one) and i've
lost count on how many shows of theirs i've been to (in the thirties
somewhere). blown away is the only phrase i can think of to describe it.
and then 2 songs later, they played "compromise". i've seen amy tear into
her electric guitar before but not like this. i'd give anything to have that
on videotape. i also love emily's background vocals on the chorus.
the guitar changes between songs are so fast there's little time for them to
chat. the show flew by, imo, or is it that the closer your seats are, the
faster time flies by?
if johnny rotten is any indication of amy's solo record to come out, i can't
wait to hear what else she's working on.
i am rooted to the ground but still blown away
rena
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 10:53:35 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: re: fw: review of cons in people magazine
mime-version: 1.0
content-type: text/plain; charset=us-ascii
>from the people magazine review:
>>bottom line: colorful outsiders shoot for pop's mainstream.<<
y'think? i didn't get this impression at all about this album. i
didn't think the girls much cared if they got mainstream play or not.
thoughts anyone?
jean
--- sherlyn koo <sherlyn@fl.net.au> wrote:
> hey folks,
>
> this was posted to the newsgroup - this is the people
> review that erin mentioned...
>
> -sherlyn
>
> ---begin forwarded message---
> from: "laura j turner" <ljturner@prodigy.net>
> subject: review of cons in people magazine
> date: fri, 15 oct 1999 20:02:40 -0400
>
> reviewed by steve dougherty
> they may not pack the cultural jolt the electrified dylan once did,
> but it
> is still something of a shock to find a pair of dyed-in-the-flannel
> folkies
> like the indigos blasting away on plugged-in guitars. the
> grammy-winning
> folk duo of amy ray and emily saliers has been putting out amped-up
> albums
> for a few years now, but they've never before rocked out as smartly
> as they
> do on "go," the sinewy, reverberating opening track of this, their
> seventh
> major label release. here they present the song's call to
> neo-feminist
> action ("don't take a seat/don't stand aside/ this time don't assume
> anything") as the kind of brainy power ballad that their athens, ga.
> ,
> neighbor, r.e.m.'s michale stipe, might sing. other candidates for
> radio
> play include "trouble", propelled by an updated bo diddley beat, and
> "peace
> tonight," a brightly wrought mid-tempo rocker that showcases the
> girl's
> harmonies in a sparkling pop setting. revered by fans for their
> lovely
> vocals and topical, passionate songs, they've also been knocked as
> overly
> earnest. dispersed among tunes like the country rocker "cold beer and
> remote
> control" and the harder "compromise" are more traditional, country
> flavored
> acoustic ballads that shine. closing the album with an old timey-
> irish-appalachian reel, the girl's show they've come a long, long,
> way baby,
> with an eerie industrial hidden track. bottom line: colorful
> outsiders shoot
> for pop's mainstream.
>
> --
> for information about the news-only version of this list send
> this command to majordomo@smoe.org: info ig-news
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 14:11:12 edt
reply-to: emilyraliers@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: vesper evensong <emilyraliers@aol.com>
subject: re: fw: review of cons in people magazine
x-to: sneakyjean@yahoo.com
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i agree that they probably weren't concerned with that. the radio stations
here probably wouldn't play any of the songs on cons because they don't fit
conveniently into any category i think...
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 14:13:41 edt
reply-to: emilyraliers@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: vesper evensong <emilyraliers@aol.com>
subject: blood and fire bootleg cd
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i lost a lot of my records...could the person to whom i sent the blood and
fire boot on cd email me and tell me if she got it? you work for a law firm
and sent me an envelope...
thanks
btw this is vesper...changed aol accounts
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 14:16:43 edt
reply-to: emilyraliers@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: vesper evensong <emilyraliers@aol.com>
subject: 3rd row seats san diego
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i buy tickets one at a time to get the best seats, so the person i go with
does not sit next to me...does anyone else do this? i got 3rd and 7th row
instead of like 2 thirds of the way back this way....just wondering. also i
usually can hear the sound check, depending on the venue..when i saw them at
the greek theatre i could hear everything, mostly rehearsing tangled up in
blue.
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 11:22:41 -0700
reply-to: sunny <sunnyig@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sunny <sunnyig@yahoo.com>
subject: johnny rotten/ mumia revisted
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hey yall -
ok johnny rotten. does anyone have a boot of this?
please? anyone? *smile*
also - mumia. i dont know if this addy has been
passed along - but i just got it from someone at work
today...so i thought id pass it along...hopefully it's
not redundant.
http://www.mumia.org/
take it easy everyone!
sunny
=====
"only two things bound to soothe my soul
cold beer and remote control"
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 14:24:16 -0400
reply-to: kelly <khager@shore.intercom.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kelly <khager@shore.intercom.net>
subject: re: fw: review of cons in people magazine
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
>>>bottom line: colorful outsiders shoot for pop's mainstream.<<
>
>y'think? i didn't get this impression at all about this album. i
>didn't think the girls much cared if they got mainstream play or not.
>thoughts anyone?
i think they couldn't be pop mainstream even if they wanted to be. that
phrase conjures up images of the backstreet boys and britney spears. that's
teenybopper music. and since the indigo girls have lyrics that actually
mean something...
oh, but getting to what you were saying (sorry about my mini-rant), i doubt
they ever try to do a song just for radio play. i mean, yeah, they have
songs that i would definitely play if i were a dj, but by and large, i think
the message is as important as the music (to steal a line from amy) and that
usually means airplay is kinda limited. :)
kelly
"it's too corny to cry." amy ray; "joking."
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
"i missed ten million miles of road i should have seen." emily saliers;
"least complicated."
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 13:36:01 -0500
reply-to: sheryl jones <sljones1@facstaff.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sheryl jones <sljones1@facstaff.wisc.edu>
subject: ebay strike again
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
i was pretty dismayed to see this item on ebay:
700+ pictures on cd
<http://cgi.ebay.com/aw-cgi/ebayisapi.dll?viewitem&item=183438520>
the examples they show are obviously downloaded off the internet and now
they're trying to sell them!!
----------------------------------------------------------
sheryl jones
sljones1@facstaff.wisc.edu
cooper seay page: http://www.geocities.com/felidae/cooper/cooper.htm
bootleg page: http://www.geocities.com/felidae/boots.htm
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 14:34:42 -0400
reply-to: nancy lambert <nlambert@inter-science.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: nancy lambert <nlambert@inter-science.com>
subject: orlando show
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
3 finger cowboy is opening!!!!!!!!!!!!!!!!!!!!!
how cool is that!???!!!!
nan
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 13:57:32 -0500
reply-to: sheryl jones <sljones1@facstaff.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sheryl jones <sljones1@facstaff.wisc.edu>
subject: re: sigc/ about tom snyder though
in-reply-to: <15050-380a347a-755@postoffice-291.iap.bryant.webtv.net>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
i remember an interview tom snyder did with brett favre a few years back.
brett was extremely popular back then and i must have seen and read about a
billion interviews with him. mr. snyder managed to have a fresh, inventive
interview that i enjoyed very much. it would be cool if he'd interview the
girls.
----------------------------------------------------------
sheryl jones
sljones1@facstaff.wisc.edu
cooper seay page: http://www.geocities.com/felidae/cooper/cooper.htm
bootleg page: http://www.geocities.com/felidae/boots.htm
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 11:59:46 -0700
reply-to: hawke2@email.msn.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: ryan blackhawke <hawke2@email.msn.com>
subject: re: ebay strike again
in-reply-to: <199910181836.naa05386@mail1.doit.wisc.edu>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
can you say copyright infringement? i knew you could. how's about we all
send email to this loser with those magic words in them? seems i've seen the
image on someone else's site and they don't appreciate their material being
stolen. i wonder how ebay feels about items which break copyright laws...
ryan
> -----original message-----
> i was pretty dismayed to see this item on ebay:
>
> 700+ pictures on cd
> <http://cgi.ebay.com/aw-cgi/ebayisapi.dll?viewitem&item=183438520>
>
> the examples they show are obviously downloaded off the internet and now
> they're trying to sell them!!
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 15:08:45 -0400
reply-to: nancy lambert <nlambert@inter-science.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: nancy lambert <nlambert@inter-science.com>
subject: re: orlando show
x-to: kim shaver <kas28024@pegasus.cc.ucf.edu>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
the date is listed under carla's show pick of the week
-----original message-----
from: kim shaver [mailto:kas28024@pegasus.cc.ucf.edu]
sent: monday, october 18, 1999 2:23 pm
to: nancy lambert
subject: re: orlando show
uh...where did you hear this? i just checked out their website since i'd
never listened to them and am going to the orlando show...and under their
tour dates it says:
10/23 montavallo al barnstormer pizza *benefit for prevention of domestic
violence*
10/24 mobile al univ. of s. al-mitchell ctr. w/ indigo girls
10/26 austin tx the backyard w/ indigo girls
???hmmm....
kim
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 15:20:33 +0000
reply-to: neily@netreach.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neily@netreach.net
subject: re: ebay strike again
x-to: hawke2@email.msn.com
> can you say copyright infringement? i knew you could. how's about we all
> send email to this loser with those magic words in them? seems i've seen the
> image on someone else's site and they don't appreciate their material being
> stolen. i wonder how ebay feels about items which break copyright laws...
i'm sure an email to ebay's support folk would zap these immediately. i know ebay doesn't
want any listings that break the law, but i guess with so many they can't check every one.
i keep an eye out on there for discs that i made (the b-sides, blue food) and i wouldn't
hesitate to get those auctions closed down. i guess an email to the seller or the person
who owns the pictures would be in order... (i think they posted about it here before, but
that message went to the big delete folder in the sky...)
i don't like the idea of self-proclaimed indigo girls police closing down every dubious
auction (if people want to sell the three early recordings cds for $300 and people are
stupid enough to pay it, then that's their lookout. i know you can get them for free here,
but someone has to buy them in the first place) but part of the way copyright works is you
have to look out for yourself (or join an organization who does it for you...)
thinking too much, as usual...
and on company time...
neil
@}--,--'--
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 15:32:40 -0400
reply-to: bean@neu.edu
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: elaine bean <bean@neu.edu>
organization: northeastern university, faculty senate office, 442 ry,
360 huntington ave., boston, ma 02115
subject: another johnny rotten question
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
susan brill wrote:
>
> that's an awesome song isn't it? really gets the crowd going. it is called
> "johnny rotten".
>
it's me - procrastinating again (and i do it so well!)
is the song that's being called "johnny rotten" actually the one that
neil young did several years back called "out of the blue and into the
black" or "rust never sleeps" or something like that? that song keeps
coming to mind - in it he makes reference to johnny rotten "the king is
gone but he's not forgotten. this is the story of johnny rotten". mr.
young absolutely rocks. so does anyone know if this is the same song
that amy did? or is there actually a song called johnny rotten? or
does she do a song by mr. rotten's former band, the sex pistols (who
also rock) ???????? does anyone care? tune in tomorrow for more
rantings and ravings from the bored one.
(what would i do without email? maybe some actual work - what a
concept)
elaine
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 13:13:32 -0700
reply-to: melissa anderson <anderson@biostat.washington.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: melissa anderson <anderson@biostat.washington.edu>
subject: ebay strike again
mime-version: 1.0
content-type: text/plain; charset=us-ascii
e-bay won't do much to stop those who violate copyright laws. i learned
the hard way. a few months ago, i bought some rare melissa etheridge cds
on ebay. they were advertised as "rare imports", but when i received them
in the mail, they were actually cd-rs. when i confronted the seller, he
told me that i should feel "lucky to have the music". and when i reported
him to ebay, they basically said that there wasn't anything that they
could do. e-bay is considering adopting a policy that would prohibit the
selling of cd-rs on ebay, but people will still get away with it if their
item description doesn't specifically say that it is a cd-r.
since e-bay won't do anything, i really think that it is up to the
community of ebay buyers to spread the word about these crooks and do
everything they can to keep them out of business. ever since i was ripped
off by that creep, i have been writing to every single person who bids on
his "rare import cds", and letting them know that they will actually
receive cd-rs. i have had almost a universally grateful response. but
unfortunately, no one sticks their neck out and leaves the bad sellers any
bad ebay feedback. therefore, the crooks stay in business.
this is kind of getting off subject, so i'll bring this to a close.
but basically, don't expect e-bay to
do anything. harass the crooks (sellers), leave bad feedback when you
know someone is a crook (you can even leave neutral feedback that says bad
things), and be sure to ask lots of questions before bidding on things.
expect the worst. once again, harass the slimy sellers, and leave honest
feedback!!
melissa, ebay vigilante
>ryan wrote:
>subject: re: ebay strike again
>can you say copyright infringement? i knew you could. how's about we all
>send email to this loser with those magic words in them? seems i've seen
>the
>image on someone else's site and they don't appreciate their material
>being
>stolen. i wonder how ebay feels about items which break copyright laws...
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 20:17:38 gmt
reply-to: that loud girl <strange_fire66@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: that loud girl <strange_fire66@hotmail.com>
subject: ig in chicago
mime-version: 1.0
content-type: text/plain; format=flowed
wxrt just announced that the dec. 5th show is their "holiday concert for the
kids", which (i believe) benefits some children's charity in the
area...whee! looks like i'll be hearing a fair bit of ig radio play in the
next couple of months...now if i could just figure out how to get tickets
without skipping class...
rock on,
shel (who highly recommends avoiding the rum cake while at work, even if its
your boss who brought it in)
______________________________________________________
get your private, free email at http://www.hotmail.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 16:30:22 edt
reply-to: erinsuepoo@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "<erin carroll>" <erinsuepoo@aol.com>
subject: average age request
x-to: bean@neu.edu
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
seeing as i have nothing important to do...i would be happy to act on the
request made for a collection of ages and find the average for anyone
interested. anyone wishing to participate can send a message with age
somewhere in the subject to erinsuepoo@aol.com all i will need is your age
(and please only do this once). i actually think this has been done before
but not for a long time...if you wish, you could also include the number of
years you have been listening to the girls.
i am 20, listening for 10 years.
look forward to hearing from y'all,
erin sue
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 16:38:52 edt
reply-to: poprckgrrl@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: poprock grrl <poprckgrrl@aol.com>
subject: re: ebay strike again
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i've seen cds like this for lots of artists...ig, ani, tori amos, etc...
think you can write to ebay and complain and get the auction cancelled or
something...since there are probably numerous copyright violations
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 16:52:26 edt
reply-to: poprckgrrl@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: poprock grrl <poprckgrrl@aol.com>
subject: more ebay
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
the person in question who is selling the ig picture cd is selling numerous
cds of all sorts of artists..korn, britney spears, garth brooks, will smith,
jennifer lopez and on and on and on..101 auctions featuring disks of some
sort...so people...if we all write to
safeharbor@ebay.com and express our displeasure. ebay does investigate and
cancel auctions without notice for things like this...
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 16:55:03 edt
reply-to: erinsuepoo@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "<erin carroll>" <erinsuepoo@aol.com>
subject: average age request
mime-version: 1.0
content-type: multipart/mixed; boundary="part1_0.eff15ed6.253ce327_boundary"
--part1_0.eff15ed6.253ce327_boundary
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
--part1_0.eff15ed6.253ce327_boundary
content-type: message/rfc822
content-disposition: inline
return-path: erinsuepoo@aol.com
from: erinsuepoo@aol.com
full-name: erinsuepoo
message-id: <0.ea9d3ca6.253ce2e6@aol.com>
date: mon, 18 oct 1999 16:53:58 edt
subject: re: average age request
to: strosenblum@students.wisc.edu
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
x-mailer: aol 4.0 for windows 95 sub 26
in a message dated 10/18/99 4:49:58 pm eastern daylight time,
strosenblum@students.wisc.edu writes:
<< i'd love to know the gender breakdown on the list also if you're feeling
ambitious! >>
have an addition to the pole if anyone is interested...gender
a simple m or f will do (if you already sent your response, you may send
another with gender or i will put you down for female...which i can tell from
some of the names amyray) if you are male, correct me!
y'all are great,
erin sue
--part1_0.eff15ed6.253ce327_boundary--
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 16:55:53 edt
reply-to: lisa071573@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lisa r <lisa071573@aol.com>
subject: johnny rotten / e-bay
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
yes please, i've never heard johnny rotten so anyone with a boot - please
share!! also, there are sooooo many copyright infringements going on at
e-bay..i don't think they care...
~lisa
"in our fear we make an image, and that image we call god." ~ingmar bergman
from the seventh seal
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 14:20:15 -0700
reply-to: diane gagnon <dispdmg@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: diane gagnon <dispdmg@yahoo.com>
subject: nigc: list setting help
mime-version: 1.0
content-type: text/plain; charset=us-ascii
can someone help me with this please? i'm trying to send a
command to listserv so that it shows me my own posts - i know it
has to do with the command repro but i can't make it work. any
helpful hints? it's a pain not being able to see what i post
(even though i don't post all that often!)
please respond to me personally - dispdmg@yahoo.com
thanks!
diane
=====
diane gagnon
dispdmg@yahoo.com
any girl can be glamorous. all you have to do is stand
still and look stupid.
~hedy lamarr
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 17:16:54 -0400
reply-to: nancy golumbia <nancyg2@sas.upenn.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: nancy golumbia <nancyg2@sas.upenn.edu>
subject: mp3's
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
hkf,
does anyone know of any good places to get some mp3's of our wonderful
girls? i've been trying all the *big* places today, and nothing was
working.
also, we went to the 3rd nyc show, and it rocked. after the show, we
*bought* our way into the *meet and greet* session, and saw ms. amy for
2 seconds as she ran out of the theater with her girlfriend. we felt,
well, kinda dumb, but it was funny, too. her girlfriend was standing
there, all grumpy, giving amy hurry-up looks.
i really only meant to post about the mp3's, but i had to share my
story...
nancy
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 14:39:12 -0700
reply-to: diane gagnon <dispdmg@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: diane gagnon <dispdmg@yahoo.com>
subject: weird
mime-version: 1.0
content-type: text/plain; charset=us-ascii
now thats weird - the last message i posted showed up. ignore
that last request, i guess!
thanx
diane
=====
diane gagnon
dispdmg@yahoo.com
any girl can be glamorous. all you have to do is stand
still and look stupid.
~hedy lamarr
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 14:28:04 pdt
reply-to: sara kitchen <sara62@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sara kitchen <sara62@hotmail.com>
subject: columbus, ohio
mime-version: 1.0
content-type: text/plain; format=flowed
howdy!
o.k. here's the deal. any one who can get me info on the columbus show on
december the 11th will be blessed. any one who can get me good tickets will
1) get face value of what you paid (just do not spend life savings; i got
rent to pay and/or 2) a full body massage from me! i sit for my state
boards in columbus on dec. 7 to get my licence for massage therapy so it is
cool to get practice!!
the last time i saw the girls, i went with a friend who had cancer, so this
would be like a closing or completion of a chapter in my life.
all thing indigo and what a blessed nite (to be;p)
sara the sunflower
______________________________________________________
get your private, free email at http://www.hotmail.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 17:49:35 -0400
reply-to: susan brill <susan.brill@yale.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: susan brill <susan.brill@yale.edu>
subject: re: another johnny rotten question
in-reply-to: <380b75d7.3a98@neu.edu>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
>is the song that's being called "johnny rotten" actually the one that
>neil young did several years back called "out of the blue and into the
>black" or "rust never sleeps" or something like that?
nope - not the same song at all. i love'em both though.
or
>does she do a song by mr. rotten's former band, the sex pistols (who
>also rock) ????????
this isn't one of those either. this is an amy ray original rockin'
mandolin song, delivered like only amy can do!
i'm pretty sure there will be boots going around soon with this song on it.
-s.
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 18:08:18 edt
reply-to: memememi@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: memememi@aol.com
subject: re: ebay strike again
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 10/18/1999 3:20:57 pm eastern daylight time,
hawke2@email.msn.com writes:
> can you say copyright infringement? i knew you could. how's about we all
> send email to this loser with those magic words in them? seems i've seen
the
> image on someone else's site and they don't appreciate their material being
> stolen. i wonder how ebay feels about items which break copyright laws...
yes, you have seen these on someone's site, and it was *mine*. i started
the legal procedure with ebay to get them removed the last time they tried
this, but it isn't finalized yet. it also appears that they have the
pictures linked directly to my site, and i am working on something to take
care of that as well. they will now be linked to a nasty note telling
interested buyers the truth about the seller.
it does appear that they have ended the auction early, so perhaps this will
end now. but if not, if you want to write them - please feel free. their
email address is: twain@dbzmail.com
i appreciate everyone's support on this. i've gotten so many kind letters,
and help. *thank you*
lisa
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 15:26:26 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: re: another johnny rotten question
mime-version: 1.0
content-type: text/plain; charset=us-ascii
like everyone else, i am looking for a boot of johnny rotten... if
someone has it i would love a copy :)
unfortuately, i don't have anything in trade... i'm new to the boot
business.
thanks!
jean
--- susan brill <susan.brill@yale.edu> wrote:
> >is the song that's being called "johnny rotten" actually the one
> that
> >neil young did several years back called "out of the blue and into
> the
> >black" or "rust never sleeps" or something like that?
>
>
> nope - not the same song at all. i love'em both though.
>
>
> or
> >does she do a song by mr. rotten's former band, the sex pistols (who
> >also rock) ????????
>
> this isn't one of those either. this is an amy ray original rockin'
> mandolin song, delivered like only amy can do!
>
> i'm pretty sure there will be boots going around soon with this song
> on it.
>
> -s.
>
> --
> for information about the news-only version of this list send
> this command to majordomo@smoe.org: info ig-news
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 17:39:59 -0500
reply-to: "margaret a. clayton" <maclayto@alumnae.mtholyoke.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "margaret a. clayton" <maclayto@alumnae.mtholyoke.edu>
subject: johnny rotten lyrics
in-reply-to: <19991018222626.21271.rocketmail@web106.yahoomail.com>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
anybody got 'em?
margaret
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 18:53:18 -0400
reply-to: mike reynolds <io20742@exploremaine.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: mike reynolds <io20742@exploremaine.com>
subject: re: ebay strike again
x-to: melissa anderson <anderson@biostat.washington.edu>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
<snip>
a few months ago, i bought some rare melissa etheridge cds
>on ebay. they were advertised as "rare imports", but when i received them
>in the mail, they were actually cd-rs. when i confronted the seller, he
>told me that i should feel "lucky to have the music".
ya know, it *still* amazes me that people think they are even going to get
"regular" non-cdr cd's now - they are extremely hard to find (a very good
bootleg trader friend of mine has a source in signapore - course it's
probably no ig stuff...) with so many cdr's out there it's crazy to think
you aren't getting a burn. but unless you're getting completely shafted (ie
over say $35 for a double cdr set - $20 for a single - let it go - and no -
i don't condone it, but yes, i have bought plenty of cdr's of ani, sinead,
pearl jam, stuff i didn't want to burn myself. there are jerks out there -
buyer beware!
. e-bay is considering adopting a policy that would prohibit the
>selling of cd-rs on ebay, but people will still get away with it if their
>item description doesn't specifically say that it is a cd-r.
why didn't you give him negative feed back? that works far more than trying
to put a "ban on cdr's - as well, i would buy some cdr's of rem, ect, if i
wanted to. i'm lucky i traded fopr most of the stuff i wanted but i can
almost guarantee you, if i could have the rem show from tweeter center for
$30 bucks in 3 days, i don't care how many people promised me it - i would
probably pick it up...
>since e-bay won't do anything, i really think that it is up to the
>community of ebay buyers to spread the word about these crooks and do
>everything they can to keep them out of business.
negative feed back is the way to go - safe harbor is a good way of doing it
too!
peace -
mike r.
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 19:03:10 edt
reply-to: jennie church <jennieum@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jennie church <jennieum@hotmail.com>
subject: e-bay and cd-rs
mime-version: 1.0
content-type: text/plain; format=flowed
warning, long!
i've been following this e-bay conversation and i just have to laugh because
people are in a tither on the other message board, a dave matthews band
board, that i visit. just a little background, dmb allows taping and
trading of their concerts. of course, they don't condone selling of their
shows, just trading. this freedom to tape allows good sounding and
plentiful recordings to come out. their management has stated on many
occasions that too much bootlegging may lead to the revocation of this tape
trading policy.
so upon seeing the insanely high cd-rs being sold on ebay, some people went
on a crusade to make the sellers' lives a little harder, making fake ebay
and yahoo accounts and bidding high on the auction. it doesn't eliminate
the selling, but it does make the sellers' life harder.
ebay just instated a policy (as of today supposedly) against the sale of any
sort of cd-r. of course, they can't catch every auction and some people try
to get around it by saying that their selling a pen and you get a free show
thrown in with it. just my 99 cents.
______________________________________________________
get your private, free email at http://www.hotmail.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 16:06:50 -0700
reply-to: lori ann <liltree@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lori ann <liltree@yahoo.com>
subject: in trouble
mime-version: 1.0
content-type: text/plain; charset=us-ascii
heya folkies,
ok, i had so little puter time last week i was
deleting messages at a rate of about 2/sec, but i was
wondering if y'all had done a little discussion on
trouble. (i know there was a sister discussion and i'm
talking bout more than just inverted syntax.) in
particular, i was wondering what y'all think bout the
"hurricane flag flappin...take out the dominican
republic" parts. some weather report in the back of
my mind is telling me, "there was a hurricane,
stupid," but baseball fan that i am, i can't help but
think about all the big hoopla surrounding sammy sosa
and pedro martinez (both from the dominican) and all
the commercials they've made aimed at tourists to get
them to visit the dominican republic. y'know, the,
come visit our beautiful golf courses and close your
eyes to the poor who could be using that as farmland,
kind of commercials. anyway...
since i, among others, have been guilty of comparing
cins songs to old stuff, here's another one i thought
of:
"and the prices are higher but the kid's still selling
lemonade" --trouble
"or maybe i should have stayed in childhood and made
my living selling lemonade" --lifeblood
coincidence?
the girls were in new york and weren't on letterman?
i thought they liked him. shucks, but maybe they'll
do leno when they go to la. also, vonda shepard is
going to be on the martin short show on october
25--anyone know if emily will sing with her? (on a
tangent, when i was going to watch the girls on rosie,
i turned to the station that carries her and they were
selling spray-on hair. totally freaked me out, i
thought they were having infomercials because there
was a baseball game in some other time zone or
something. turned out to be just ron popeil (sp?) on
the martin short show.)
lori (who would have sent kevin millwood to the mound
to start the 15th)
=====
"i hate to admit i'm licked, but i'm licked." --velma
"me too, velma." --debbie
--from scooby doo meets speed buggy
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 18:55:46 -0500
reply-to: barbara bordner <barbinmn@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: barbara bordner <barbinmn@webtv.net>
subject: fwd: re: some audience members
content-type: multipart/mixed; boundary=webtv-mail-31096-6591
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
--webtv-mail-31096-6591
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
--webtv-mail-31096-6591
content-disposition: inline
content-type: message/rfc822
content-transfer-encoding: 7bit
x-webtv-signature: 1
etatahuarg904dckdrybpokanwxr5+oh3iqcfe8leyma8brtiz1fzoc4u/jshfyd
from: barbinmn@webtv.net (barbara bordner)
date: mon, 18 oct 1999 18:53:50 -0500 (cdt)
to: erinsuepoo@aol.com
subject: re: some audience members
message-id: <15047-380bb30e-4927@postoffice-291.iap.bryant.webtv.net>
in-reply-to: "<erin carroll>" <erinsuepoo@aol.com>'s message of mon, 18 oct 1999 09:58:45 edt
content-disposition: inline
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
i like what erin said about standing inthe audience. i can understand
that mos people come to rock concerts to sing and dance, and have fun,
and i don't mind it as much when people on first floor are standing.
but it amazes
me when that behavior spreads up nto the balcony where i go to flee
that.
can't some people understand that the person behind them might not be
able to stand up through a whole show, just to see? that is really
inconsiderate , besides that i prefer to sit
at an ig show, because i can put more energy into the music, when i am
relaxed and seated.
and yes ihave my periods when i like to scream and shout too, ig do
allow for that depending on the situation. if it's simply fun to cheer
your
favorite people on, and feel the rush, and it's a rebel rousing song.
and the whole croud is enthused, but there are limits. during a quiet
part of the show i would rather be quiet and listen to what the girls
say, 1) they don't talk very much, 2) when they do talk they usually
have something very interesting to say. 3) they get ya involved in wht
goes on around you.
some people don't like to hear politics brought up at shows because all
they want is a get away from the world's troubles that's okay. they
need to keep in mind the girls are a political group, and if
they have an agenda they do publicize the fact,
so that the kind of people who like that about them will come. and
those who don't like it would have little reason to grouse afterwards
right? that's my 2 cents worth.
peace,
barb
--webtv-mail-31096-6591--
--
for information about the news-only version of this list send
this command to majordomo@smoe.org: info ig-news
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 20:26:55 -0400
reply-to: neil <neily@netreach.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neil <neily@netreach.net>
subject: the 'official' list discography part i (rather long indeed...)
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
folks...
the baton has been passed. the keeper of the sacred discography, steve
clark, has grown weary of his task. and so it is i who have accepted the
challange to keep, update, and feed twice daily our very own list
discography. before i spiff it up and post it on my webpages (i'm hoping to
add lots o' graphics and additional information) i thought i'd post it here
and ask for your help to clarify and correct any errors and omissions there
may be.
and if anyone has chart placings, # of copies sold, release dates (apart
from those on the official site, i can nick those myself) and other anoraky
stuff, then i'd be glad to have them!
oh, and if anyone can provide copies of emilys solo tape and/or the live at
san fransisco tape (or knows where i can obtain them at any price), i hope
to make it worth your while in some small way...
enjoy...
> indigo girls <
copyright 1992-1999
last modified 18-oct-1999 neily@netreach.net
please send additions and corrections to the above address.
this discography has been compiled on behalf of the internet indigo
girls electronic mailing list (see below). please retain this
attribution if reproducing a significant portion of the
discography.
may not be distributed for financial gain.
notation:
entries marked * are listed in the summer 1992 schwann "spectrum",
page number indicated.
tracks marked (l) or (live) are recorded live; all other tracks are
studio recordings.
artist abbreviations (fourth column):
indigo girls:
ar = amy ray
es = emily saliers
friends who turn up frequently:
ejs = ellen james society (mcguire/seay/lilje/bland)
mcc = mary-chapin carpenter
mm = michelle malone
> indie releases
>> singles
#001) crazy game/everybody's waiting (for someone to come home)
jellis records vinyl: a1264 (ps)
summer 1985
time: 8:48
-------------------------------------------------------------
#001.1 crazy game 3:36 es
#001.2 everybody's waiting (for someone 5:12 ar
to come home)
>> eps
#002) indigo girls (ep)
dragon path music vinyl: lmm 1
november 1986 cs promo: lmm 1
about 60 clear vinyl copies were made. some blue vinyl
copies were made. vinyl color cannot be determined without
removing shrink wrap.
time:
-------------------------------------------------------------
#002.1 land of canaan ar
#002.2 lifeblood es
#002.3 history of us es
-
#002.4 never stop es
#002.5 cold as ice ar
#002.6 finlandia sibelius
>> albums
#003) blue food
official bootleg cs: <unnumbered>
1985
recorded live at the dugout, atlanta, except as noted.
time:
-------------------------------------------------------------
#003.1 if you live like that (live) ar/es
#003.2 crazy game (live) es
#003.3 holy city (live) ar
#003.4 the weakness in me (live) j. armatrading
#003.5 never stop (live) es
#003.6 peace song (live) es
#003.7 draw the line (studio) ar
#003.8 nashville (live) ar
#003.9 malachi's (live) the roches
-
#003.10 everybody's waiting (for someone 5:12 ar
to come home) (studio)+
#003.11 the untitled song (live) es
#003.12 running from the cold (live) ar
#003.13 no way to treat a friend (live) ar
#003.14 i don't know your name (live) ar/es
#003.15 american tune (live) p. simon
+ from crazy game single (jellis records a1264)
#004) strange fire
indigo music vinyl: lmm 2
october 1987 cs promo: lmm 2
a total of about 7000 copies were made, including about 60
on clear vinyl, some on red vinyl, and some on blue vinyl.
there apparently was a second pressing, which has "second
edition" printed on the disk label.
rereleased with altered sequence as epic ek-45427
time:
-------------------------------------------------------------
#004.1 make it easier 4:00 es
#004.2 walk away 5:29 ar
#004.3 crazy game 2:53 es
#004.4 i don't wanna know 3:17 mm/ar
#004.5 you left it up to me 4:57 ar
#004.6 hey, jesus 4:08 es
-
#004.7 strange fire 5:30 ar
#004.8 high horse 4:58 es
#004.9 left me a fool 4:54 es
#004.10 land of canaan ar
#004.11 blood and fire ar
> notable non-official cassettes
#005) the b band: tuesday's children
a unicorn production cs: <unnumbered>
1981
time: 55:00
-------------------------------------------------------------
#005.1 wisteria fogelberg
#005.2 carolina on my mind j. taylor
#005.3 a junkie's lament j. taylor
#005.4 her town too j. taylor
#005.5 the house at pooh corner loggins
#005.6 danny's song loggins
#005.7 rock me on the water browne
#005.8 father and son cat stevens
-
#005.9 come down in time e. john/b. taupin
#005.10 it's too late c. king
#005.11 you've got a friend c. king
#005.12 dancing shoes fogelberg
#005.13 long ago and far away j. taylor
#005.14 leaving ain't fair es
#005.15 a heart in new york benny gallagher/graham lyle
#005.16 tuesday's children ar
#006) color me grey
1985 cs: <unnumbered>
"amy's solo album" - informally circulated tape
time:
-------------------------------------------------------------
#006.1 scared to say we're friends ar
#006.2 nashville ar
#006.3 fallin' star ar
#006.4 carry me away ar
#006.5 anyway, i love you ar
#006.6 clues to you ar
#006.7 always be there ar
#006.8 color me grey ar
#006.9 free through eternity ar
#006.10 passing time ar
#006.11 losin' touch ar
#006.12 erase the pain ar
#006.13 anyone but myself ar
**************************************************
a solo tape by emily titled : here for you, recorded supposedly in
1983 (with extra guitar work by jonathan harder), and contains:
maybe it's the vision
i know that i love you
no trespassing
i hope i'm here for you
when your heart needs a home
gray new orleans afternoon
no one ever told me
half moon cafe
untitled
white flag
play it again sam
better life
**************************************
#007) purple parrot
1985 cs: <unnumbered>
recorded live at the purple parrot
time:
-------------------------------------------------------------
#007.1 no way to treat a friend (live) ar
#007.2 if you live like that (live) ar/es
#007.3 the weakness in me (live) j. armatrading
#007.4 love of the common people (live) j. hurley/r. wilkens
#007.5 the house at pooh corner (live) loggins
#007.6 danny's song (live) loggins
#007.7 holy city (live) ar
#007.8 never stop (live) es
#007.9 hammond song (live) the roches
#007.10 drift away (live) d. gray
-
#007.11 love the one you're with (live) s. stills
#007.12 draw the line (live) ar
#007.13 girls' talk (live) e. costello
#007.14 the water is wide (live) traditional
#007.15 the untitled song (live) es
#007.16 everybody's waiting (for someone ar
to come home) (live)
#007.17 crazy game (live) es
#007.18 up on the roof (live) goffin/c. king
#007.19 country road (live) j. taylor
#007.20 it's too late (live) c. king
#007.21 summertime (live) heyward/gershwin
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 20:29:14 -0400
reply-to: neil <neily@netreach.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neil <neily@netreach.net>
subject: discography part ii
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
> commercial releases
>> studio albums
#008) indigo girls
epic cd: ek-45044 [ddd] *
february 21, 1989 cs: fet-45044 *
* schwann p. 130 vinyl: e-45044
other releases:
uk july 1989 cd: 463491-2
cs: 463491-4
vinyl: 4 63491-1
us december 1994 gold cd: ek-66224
time: 43:53
-------------------------------------------------------------
#008.1 closer to fine 3:59 es
#008.2 secure yourself 3:34 ar
#008.3 kid fears 4:33 ar
#008.4 prince of darkness 5:22 es
#008.5 blood and fire 4:37 ar
#008.6 tried to be true 2:56 ar
#008.7 love's recovery 4:21 es
#008.8 land of canaan 3:55 ar
#008.9 center stage 4:46 ar
#008.10 history of us 5:20 es
#009) strange fire
epic cd: ek-45427 [aad] *
october 31, 1989 cs: fet-45427 *
* schwann p. 130 vinyl: e-45427
this is a modified reissue of indigo records lmm ii
time: 42:49
-------------------------------------------------------------
#009.1 strange fire 5:30 ar
#009.2 crazy game 2:53 es
#009.3 left me a fool 4:54 es
#009.4 i don't wanna know 3:17 mm/ar
#009.5 hey, jesus 4:08 es
#009.6 get together 3:32 c. powers
#009.7 walk away 5:29 ar
#009.8 make it easier 4:00 es
#009.9 you left it up to me 4:57 ar
#009.10 land of canaan+ 4:09 ar
+ this is not the same mix that appears on lmm ii.
#010) nomads*indians*saints
epic cd: ek-46820 [ddd] *
september 18, 1990 cs: et-46820 *
* schwann p. 130 vinyl: e-46820 * (one printing?)
vinyl promo: aer-46820
other releases:
uk november 1990 cd: 467308-2
cs: 467308-4
cs: 467308-1
time: 47:23
-------------------------------------------------------------
#010.1 hammer and a nail 3:51 es
#010.2 welcome me 4:37 ar
#010.3 world falls 3:45 ar
#010.4 southland in the springtime 4:20 es
#010.5 1 2 3 4:16 ar/ejs
#010.6 keeper of my heart 4:22 ar
#010.7 watershed 5:45 es
#010.8 hand me downs 3:42 ar
#010.9 you and me of the 10,000 wars 4:11 es
#010.10 pushing the needle too far 4:13 ar
#010.11 the girl with the weight of 4:20 es
the world in her hands
#011) rites of passage
epic cd: ek-48865 [aad] *
may 12, 1992 cs: et-48865 *
* schwann p. 31 cd promo: esk-4552
brown cd; no liner notes;
black and white back cover
cd promo: esk-4570
digipak; no liner notes;
picture disc
vinyl promo: eas-4526
hand painted cover by ar/es
vinyl promo: eas-4541
blank white sleeve
other releases:
uk 1992 cd: 471363-2
cs: 471363-4
vinyl: 471363-1
time: 57:44
-------------------------------------------------------------
#011.1 three hits 3:10 ar
#011.2 galileo 4:12 es
#011.3 ghost 5:13 es
#011.4 joking 3:33 ar
#011.5 jonas and ezekial 4:07 ar
#011.6 love will come to you 4:36 es
#011.7 romeo and juliet 4:45 m. knopfler
#011.8 virginia woolf 5:25 es
#011.9 chickenman 5:42 ar
#011.10 airplane 3:26 es
#011.11 nashville 3:56 ar
#011.12 let it be me 3:53 es
#011.13 cedar tree 3:46 ar
#012) swamp ophelia
epic cd: ek-57621
may 10, 1994 cs: et-57621
vinyl: em-57621
uk vinyl: ???
us lp's were a limited run of 3500 (6000?), all signed by
both amy and emily. some are translucent green vinyl;
vinyl color cannot be determined without removing shrink
wrap.
other releases:
uk 1994 cd: 475931 2
cs: 475931 4
vinyl: 475931 1
time:
-------------------------------------------------------------
#012.1 fugitive ar
#012.2 least complicated 4:13 es
#012.3 language or the kiss es
#012.4 reunion ar
#012.5 power of two es
#012.6 touch me fall 4:46 ar
-
#012.7 wood song es
#012.8 mystery es
#012.9 dead man's hill ar
#012.10 fare thee well es
#012.11 this train (revised) ar
#013) jesus christ superstar (a resurrection)
daemon cd: 19006-4
1994
conceived by michael lorant (big fish ensemble). ar as
jesus, es as mary magdelene, and billions and billions of
other atlanta musicians in other roles.
benefit for gun control.
time:
-------------------------------------------------------------
#014) 4.5 - the best of the indigo girls
epic cd: 480439 2
july 1995 cs: 480439 4
cd promo: xpcd-650
uk only
promo is in digipak with brief discography.
time:
-------------------------------------------------------------
#014.1 joking+++ 3:33 ar
#014.2 hammer and a nail++ 3:51 es
#014.3 kid fears+ 4:33 ar
#014.4 galileo+++ 4:12 es
#014.5 tried to be true+ 2:56 ar
#014.6 power of two++++ es
#014.7 pushing the needle too far++ 4:13 ar
#014.8 reunion++++ ar
#014.9 closer to fine+ 3:59 es
#014.10 three hits+++ 3:10 ar
#014.11 least complicated++++ 4:13 es
#014.12 touch me fall++++ 4:46 ar
#014.13 love's recovery+ 4:21 es
#014.14 land of canaan+ 3:55 ar
#014.15 ghost+++ 5:13 es
+ from indigo girls (epic ek-45044)
++ from nomads*indians*saints (epic ek-46820)
+++ from rites of passage (epic ek-48865)
++++ from swamp ophelia (epic ek-57621)
#015) shaming of the sun
epic cd: ek-67891 (jewel box)
april 29, 1997 cd: ek-68019 (digipak)
cs: et-67891
cd promo: aek-67891
time: 50:51
-------------------------------------------------------------
#015.1 shame on you 4:03 ar
#015.2 get out the map 3:26 es
#015.3 shed your skin 4:11 ar
#015.4 it's alright 3:04 es
#015.5 caramia 5:48 es
#015.6 don't give that girl a gun 4:40 ar
#015.7 leeds 3:33 es
#015.8 scooter boys 2:57 ar
#015.9 everything in its own time 5:17 es
#015.10 cut it out 3:53 ar
#015.11 burn all the letters 4:13 es
#015.12 hey kind friend 5:46 ar
#016) indigo girls starter kit
sony music special products cd: a 28551
april 1997
time: 29:57
-------------------------------------------------------------
#016.1 galileo+++ 4:12 es
#016.2 welcome me++ 4:37 ar
#016.3 least complicated++++ 4:13 es
#016.4 three hits+++ 3:10 ar
#016.5 ghost+++ 5:13 es
#016.6 kid fears+ 4:33 ar
#016.7 closer to fine+ 3:59 es
+ from indigo girls (epic ek-45044)
++ from nomads*indians*saints (epic ek-46820)
+++ from rites of passage (epic ek-48865)
++++ from swamp ophelia (epic ek-57621)
#017) indigo girls/strange fire/nomads*indians*saints [box]
sony cd: ek-65609
june 30, 1998
box set containing all three cds.
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
time:
-------------------------------------------------------------
#017.1 closer to fine 3:59 es
#017.2 secure yourself 3:34 ar
#017.3 kid fears 4:33 ar
#017.4 prince of darkness 5:22 es
#017.5 blood and fire 4:37 ar
#017.6 tried to be true 2:56 ar
#017.7 love's recovery 4:21 es
#017.8 land of canaan 3:55 ar
#017.9 center stage 4:46 ar
#017.10 history of us 5:20 es
#017.11 strange fire 5:30 ar
#017.12 crazy game 2:53 es
#017.13 left me a fool 4:54 es
#017.14 i don't wanna know 3:17 mm/ar
#017.15 hey, jesus 4:08 es
#017.16 get together 3:32 c. powers
#017.17 walk away 5:29 ar
#017.18 make it easier 4:00 es
#017.19 you left it up to me 4:57 ar
#017.20 land of canaan+ 4:09 ar
#017.21 hammer and a nail 3:51 es
#017.22 welcome me 4:37 ar
#017.23 world falls 3:45 ar
#017.24 southland in the springtime 4:20 es
#017.25 1 2 3 4:16 ar/ejs
#017.26 keeper of my heart 4:22 ar
#017.27 watershed 5:45 es
#017.28 hand me downs 3:42 ar
#017.29 you and me of the 10,000 wars 4:11 es
#017.30 pushing the needle too far 4:13 ar
#017.31 the girl with the weight of 4:20 es
the world in her hands
>> live releases
#018) back on the bus, y'all (ep)
epic cd: ek-47508 *
june 6, 1991 cs: et-47508 *
* schwann p. 130 vinyl: e-47508
vinyl promo: eas-4020
other releases:
uk september 1991 cd: 468415-2
cs: 468415-4
vinyl: 468415-1
recorded live at notre dame university, west georgia college,
and the uptown lounge.
time: 38:59
-------------------------------------------------------------
#018.1 1 2 3 4:30 ar/ejs
#018.2 tried to be true 2:56 ar
#018.3 you and me of the 10,000 wars 4:21 es
#018.4 prince of darkness 6:01 es
#018.5 kid fears 4:58 ar
#018.6 left me a fool 5:31 es
#018.7 all along the watchtower++ 6:26 b. dylan
#018.8 1 2 3 (studio)+ 4:16 ar/ejs
+ from nomads*indians*saints (epic ek-46820)
++ from live at the uptown lounge (cbs 19v-49029)
#019) 1200 curfews
epic cd: e2k 67229
october 10, 1995
other releases:
australia 1995 cd: 481023-2
us wooden box promo cd:
numbered; includes guitar pick
double live cd; recorded during the "swamp ophelia" and
1995 "honor the earth" tours as well as choice tracks from
earlier shows.
time: 144:54
-------------------------------------------------------------
#019.1 joking 4:26 ar
#019.2 least complicated 5:15 es
#019.3 thin line 4:21 gerard mchugh
#019.4 river 3:52 j. mitchell
#019.5 strange fire 5:13 ar
#019.6 power of two 5:16 es
#019.7 pushing the needle too far 4:20 ar
#019.8 virginia woolf 6:04 es
#019.9 jonas and ezekial 3:53 ar
#019.10 tangled up in blue 8:05 b. dylan
#019.11 world falls 3:52 ar
#019.12 bury my heart at wounded knee 5:07 b. saint-marie
#019.13 ghost 6:03 es
#019.14 dead man's hill 5:34 ar
-
#019.15 i don't wanna know 3:46 mm/ar
#019.16 galileo 5:28 es
#019.17 down by the river 9:43 n. young
#019.18 love's recovery 5:02 es
#019.19 land of canaan 4:25 ar
#019.20 mystery 4:48 es
#019.21 this train (revised) 6:39 ar
#019.22 back together again 2:02 es
#019.23 language or the kiss 5:44 es
#019.24 chickenman 7:26 ar
#019.25 midnight train to georgia 5:18 wheatherbey
#019.26 closer to fine 4:47 es
#019.27 bury my heart at wounded knee(s) 5:13 b. saint-marie
#019.28 go, go, go+ 2:40 ar
+ unlisted bonus track
>> cd singles
#020) closer to fine (uk)
epic cd: 654907-2
june 1989
time: 14:05
-------------------------------------------------------------
#020.1 closer to fine+ 3:59 es
#020.2 history of us+ 5:20 es
#020.3 center stage+ 4:46 ar
+ from indigo girls (epic ek-45044)
#021) closer to fine ep (uk)
epic cd: 655135-2
july 1989
time: 18:01
-------------------------------------------------------------
#021.1 closer to fine+ 3:59 es
#021.2 intro/closer to fine (live)++ 4:20 es
#021.3 mona lisas and mad hatters (l)++ 5:36 e. john/b. taupin
#021.4 american tune (live)++ 4:06 p. simon
+ from indigo girls (epic ek-45044)
++ from reverse 1 - live (epic esk-1670)
#022) galileo ep (australia)
epic cd: 6 58156-2
1992
time: 10:30
-------------------------------------------------------------
#022.1 galileo+ 4:12 es
#022.2 clip: ghost+ 2:06 es
#022.3 clip: joking+ 1:28 ar
#022.4 clip: love will come to you+ 2:00 es
#022.5 clip: jonas and ezekial+ 1:24 ar
+ from rites of passage (epic ek-48865)
++ from back on the bus, y'all (epic ek-47508)
#023) galileo ep (austria/uk)
epic cd: 658768-2
october 1992
time: 14:57
-------------------------------------------------------------
#023.1 galileo+ 4:12 es
#023.2 closer to fine++ 3:59 es
#023.3 tried to be true++ 2:57 ar
#023.4 hammer and a nail+++ 3:49 es
+ from rites of passage (epic ek-48865)
++ from indigo girls (epic ek-45044)
+++ from nomads*indians*saints (epic ek-46820)
#024) galileo ep (holland)
epic cd: 6 58040-2
1992
time: 15:28
-------------------------------------------------------------
#024.1 galileo+ 4:12 es
#024.2 clip: ghost+ 2:06 es
#024.3 clip: joking+ 1:28 ar
#024.4 clip: love will come to you+ 2:00 es
#024.5 clip: jonas and ezekial+ 1:24 ar
#024.6 kid fears++ 4:58 ar
+ from rites of passage (epic ek-48865)
++ from back on the bus, y'all (epic ek-47508)
#025) joking ep (holland)
epic cd: 6 58344-2
1992
time: 12:07
-------------------------------------------------------------
#025.1 joking+ 3:33 ar
#025.2 closer to fine++ 4:00 es
#025.3 kid fears++ 4:34 ar
+ from rites of passage (epic ek-48865)
++ from indigo girls (epic ek-45044)
#026) i don't wanna talk about it (holland)
epic cd: 6 60209-1
1994
time: 8:21
-------------------------------------------------------------
#026.1 i don't wanna talk about it 3:37 danny whitten
#026.2 galileo (live)++ 4:44 es
+ from philadelphia soundtrack (epic soundtrax 57624)
++ recorded live at the fox theater, atlanta, 11/27/92
#027) touch me fall (holland)
epic cd: 6 60766-2
1994
comes with cd single by "the choice" (now known as k's choice),
"i smoke a lot".
time:
-------------------------------------------------------------
#027.1 touch me fall (edit) ar
#027.2 ??
#027.3 ??
#028) least complicated ep (holland)
epic cd: 6 60340-1
1994
time: 8:48
-------------------------------------------------------------
#028.1 least complicated+ 4:13 es
#028.2 dead man's hill++ 4:35 ar
+ from swamp ophelia (epic ek-57621)
++ special acoustic version
#029) least complicated ep (uk)
epic cd: 660340-2
may 1994
time: 17:32
-------------------------------------------------------------
#029.1 least complicated+ 4:13 es
#029.2 dead man's hill++ 4:35 ar
#029.3 mystery++ 4:06 es
#029.4 kid fears+++ 4:36 ar
+ from swamp ophelia (epic ek-57621)
++ special acoustic version
+++ from indigo girls (epic ek-45044)
#030) least complicated ep (uk/austria)
epic cd: 660340-2
1994
yes, the number really is the same as the 4-track uk least
complicated single.
time: 12:56
-------------------------------------------------------------
#030.1 least complicated+ 4:13 es
#030.2 dead man's hill++ 4:35 ar
#030.3 mystery++ 4:06 es
+ from swamp ophelia (epic ek-57621)
++ special acoustic version
#031) least complicated ep (australia)
epic cd: 6 60444-2
1994
spine says "touch me fall".
time: 20:30
-------------------------------------------------------------
#031.1 least complicated+ 4:13 es
#031.2 dead man's hill++ 4:35 ar
#031.3 mystery++ 4:06 es
#031.4 i don't wanna talk about it+++ 3:37 danny whitten
#031.5 closer to fine++++ 3:59 es
+ from swamp ophelia (epic ek-57621)
++ special acoustic version
+++ from philadelphia soundtrack (epic soundtrax 57624)
++++ from indigo girls (epic ek-45044)
#032) touch me fall (australia)
epic cd: 6 60637-2
1994
time: 12:04
-------------------------------------------------------------
#032.1 touch me fall+ 4:46 ar
#032.2 wood song++ 3:58 es
#032.3 reunion++ 3:20 ar
+ from swamp ophelia (epic ek-57621)
++ special acoustic version
#033) wood song (germany)
epic cd promo: ???
1994
only 100 made. guessing at most info.
time:
-------------------------------------------------------------
#033.1 wood song+ es
+ from swamp ophelia (epic ek-57621)
#034) power of two (us, australia, uk)
epic cd: 34k 77844
february 1995 aus cd: 661342-1
uk cd (promo?): 661347-2
time: 18:09
-------------------------------------------------------------
#034.1 power of two+ 4:50 es
#034.2 dead man's hill++ 4:31 ar
#034.3 mystery++ 4:03 es
#034.4 rockin' in the free world (l)+++ 4:45 n. young
+ edit from swamp ophelia (epic ek-57621)
++ special acoustic version
+++ recorded live in atlanta 12/19/94 with k's choice
#035) touch me fall (australia)
epic cd: 6 61237-2
1995
time: 12:04
-------------------------------------------------------------
#035.1 touch me fall+ 4:46 ar
#035.2 least complicated++ 3:50 es
#035.3 wood song++ 3:58 es
+ from swamp ophelia (epic ek-57621)
++ special acoustic version
#036) touch me fall (uk)
epic cd (promo?): ???
1995
time: 18:05
-------------------------------------------------------------
#036.1 touch me fall+ 4:46 ar
#036.2 dead man's hill++ 4:31 ar
#036.3 mystery++ 4:03 es
#036.4 rockin' in the free world (l)+++ 4:45 n. young
+ from swamp ophelia (epic ek-57621)
++ special acoustic version
+++ recorded live in atlanta 12/19/94 with k's choice
#037) closer to fine (uk)
epic cd: 662166-2
withdrawn, june 1995
withdrawn before official release, but review copies were
circulated.
time: 17:33
-------------------------------------------------------------
#037.1 closer to fine+ 3:59 es
#037.2 dead man's hill++ 4:31 ar
#037.3 mystery++ 4:03 es
#037.4 rockin' in the free world (l)+++ 4:45 n. young
+ from indigo girls (epic ek-45044)
++ special acoustic version
+++ recorded live in atlanta 12/19/94 with k's choice (aka the choice)
#038) closer to fine (uk)
epic cd: 662166-5
withdrawn, june 1995
withdrawn before official release.
time: 20:28
-------------------------------------------------------------
#038.1 closer to fine+ 3:59 es
#038.2 kid fears+ 4:33 ar
#038.3 all along the watchtower (l)++ 6:26 b. dylan
#038.4 left me a fool (live)++ 5:30 es
+ from indigo girls (epic ek-45044)
++ from back on the bus, y'all (epic ek-47508)
#039) bury my heart at wounded knee (us)
epic cd: ???
october 1995
time:
-------------------------------------------------------------
#039.1 bury my heart at wounded knee b. saint-marie
#039.2 thin line (live)+ gerard mchugh
#039.3 bury my heart at wounded knee (l)++ b. saint-marie
+ radio edit from 1200 curfews (epic e2k 67229)
++ from 1200 curfews (epic e2k 67229)
#040) shame on you (uk?)
epic cd: m030410
july 1997
time:
-------------------------------------------------------------
#040.1 shame on you+ 4:03 ar
#040.2 closer to fine++ 3:59 es
#040.3 least complicated+++ 4:13 es
#040.4 bury my heart at wounded knee b. saint-marie
+ from shaming of the sun (epic ek-67891)
++ from indigo girls (epic ek-45044)
+++ from swamp ophelia (epic ek-57621)
>> cassingles
#041) closer to fine/cold as ice
epic cs: 34t 68912
1989
time:
-------------------------------------------------------------
#041.1 closer to fine+ 3:59 es
#041.2 cold as ice++ ar
+ from indigo girls (epic ek-45044)
++ from indigo girls ep (dragon path music lmm1)
#042) land of canaan/never stop
epic cs: 34t 73003
1989
time:
-------------------------------------------------------------
#042.1 land of canaan ar
#042.2 never stop++ es
++ from indigo girls ep (dragon path music lmm1)
#043) get together/finlandia
epic cs: 34t 73255
1990
time:
-------------------------------------------------------------
#043.1 get together+ 3:32 c. powers
#043.2 finlandia++ sibelius
+ from strange fire (epic ek-45427)
++ from indigo girls ep (dragon path music lmm1)
#044) hammer and a nail/welcome me
epic cs: 34t 73607
1990
time: 7:59
-------------------------------------------------------------
#044.1 hammer and a nail+ 3:51 es
#044.2 welcome me (live)++ 4:08 ar
+ from nomads*indians*saints (epic ek-46820)
++ from live at the uptown lounge (cbs 19v-49029)
#045) galileo/other clips
epic cs: 34t 74326
1992
time:
-------------------------------------------------------------
#045.1 galileo+ 4:12 es
#045.2 clip: ghost+ es
#045.3 clip: joking+ ar
#045.4 clip: love will come to you+ es
#045.5 clip: jonas and ezekial+ ar
+ from rites of passage (epic ek-48865)
#046) galileo/kid fears (uk)
epic cs: 658768-4
october 1992
time: 8:45
-------------------------------------------------------------
#046.1 galileo+ 4:12 es
-
#046.2 kid fears++ 4:33 ar
+ from rites of passage (epic ek-48865)
++ from indigo girls (epic ek-45044)
#047) joking/airplane
epic cs: 34t 74434
1992
time: 13:58
-------------------------------------------------------------
#047.1 joking+ 3:33 ar
#047.2 airplane+ 3:26 es
-
b side is identical
+ from rites of passage (epic ek-48865)
#048 least complicated/dead man's hill
epic cs: 34t-77607
1994
time: 8:48
-------------------------------------------------------------
#048.1 least complicated+ 4:13 es
-
#048.2 dead man's hill++ 4:35 ar
+ from swamp ophelia (epic ek-57621)
++ special acoustic version
#049 power of two
epic cs: 34t-77888
1995
time: 9:35
-------------------------------------------------------------
#049.1 power of two+ 4:50 es
-
#049.2 rockin' in the free world (l)++ 4:45 n. young
+ edit from swamp ophelia (epic ek-57621)
++ recorded live in atlanta 12/19/94 with k's choice
>> vinyl singles
#050) closer to fine/cold as ice
epic vinyl: 34-68912
1989
time:
-------------------------------------------------------------
#050.1 closer to fine+ 3:59 es
-
#050.2 cold as ice++ ar
+ from indigo girls (epic ek-45044)
++ from indigo girls ep (dragon path music lmm1)
#051) closer to fine (uk 12")
epic vinyl 12": 654907-5
june 1989
time: 18:01
-------------------------------------------------------------
#051.1 closer to fine+ 3:59 es
#051.2 center stage+ 4:46 ar
#051.3 history of us+ 5:20 es
+ from indigo girls (epic ek-45044)
#052) closer to fine (uk)
epic vinyl: 654907-7
1989
time: 9:19
-------------------------------------------------------------
#052.1 closer to fine+ 3:59 es
#052.2 history of us+ 5:20 es
+ from indigo girls (epic ek-45044)
#053) closer to fine (uk 12")
epic vinyl 12": 654907-8
june 1989
time: 18:01
-------------------------------------------------------------
#053.1 closer to fine+ 3:59 es
#053.2 intro/closer to fine (live)++ 4:20 es
-
#053.3 mona lisas and mad hatters (l)++ 5:36 e. john/b. taupin
#053.4 american tune (live)++ 4:06 p. simon
+ from indigo girls (epic ek-45044)
++ from reverse 1 - live (epic esk-1670)
#054) closer to fine (spain)
epic vinyl: arie 2221
1989
time: 3:59
-------------------------------------------------------------
#054.1 closer to fine 3:59 es
#055) land of canaan/never stop
epic vinyl: ???
1989
time:
-------------------------------------------------------------
#055.1 land of canaan+ 3:55 ar
-
#055.2 never stop++ es
+ from indigo girls (epic ek-45044)
++ from indigo girls ep (dragon path music lmm1)
#056) galileo/kid fears (uk)
epic vinyl: 658768-7
1992
time:
-------------------------------------------------------------
#056.1 galileo+ 4:12 es
-
#056.2 kid fears++ 4:33 ar
+ from rites of passage (epic ek-48865)
++ from indigo girls (epic ek-45044)
>> box sets
#057) indigo girls/strange fire/nomads*indians*saints
epic cd: ???
1998
slip-cased package including these three releases, unmodified.
time:
-------------------------------------------------------------
includes indigo girls (epic ek-45044)
includes strange fire (epic ek-45427)
includes nomads*indians*saints (epic ek-46820)
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 20:31:59 -0400
reply-to: neil <neily@netreach.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neil <neily@netreach.net>
subject: discography part iii
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
> promotional releases
>> full length albums
#058) reverse 1 - live
epic cd promo: esk-1670
1989
recorded live at the little five points pub, atlanta, ga,
may 9, 1989.
time: 38:41
-------------------------------------------------------------
#058.1 intro/closer to fine (live) 4:30 es
#058.2 land of canaan (live) 4:05 ar
#058.3 love of the common people (live) 3:22 j. hurley/r. wilkens
#058.4 crazy game (live) 3:09 es
#058.5 kid fears (live) 5:10 ar
#058.6 mona lisas and mad hatters (l) 5:36 e. john/b. taupin
#058.7 american tune (live) 4:06 p. simon
#058.8 closer to fine (studio)+ 4:01 es
#058.9 kid fears (studio)+ 4:32 ar
+ from indigo girls (epic ek-45044)
#059) shades of indigo
epic cd promo: esk-2201
december 1990 two covers are available:
one orange, one purple
vinyl promo: eas-2201
two covers are available:
one green, one purple
only 1000 were made
each song preceded by a track of conversation with shawn
colvin. recorded live at the paramount theater, denver,
co, october 21-22, 1990.
time: 54:59 (including interviews)
-------------------------------------------------------------
#059.1 1 2 3 (studio)+ 4:16 ar/ejs
#059.2 southland in the springtime (s)+ 4:20 es
#059.3 hammer and a nail (live) 3:45 es
#059.4 melissa (live) 4:30 g. allman/s. alaimo
#059.5 watershed (live) 5:33 es
#059.6 pushing the needle too far (l) 4:07 ar
#059.7 you and me of the 10,000 wars(l) 4:16 es
#059.8 daddy's all gone (live) 3:41 j. taylor
+ from nomads*indians*saints (epic ek-46820)
#060) general foods international coffee promo disc
kraft general foods cd promo: shows 25-26
spring 1992
recorded at quad recording studio, nyc, during rites of
passage recording sessions.
ig portion is all acoustic, no band.
in-studio appearance including interview by pat dinizzio.
only 200 were made.
time: 55:23
-------------------------------------------------------------
#060.1 indigo girls 26:41
#060.1a cedar tree (live) ar
#060.1b love will come to you (live) es
#060.1c ghost (live) es
#060.1d jonas and ezekial (live) ar
#060.2 spin doctors/dave alvin 28:17
#060.3 spin doctors/dave alvin promo :25
#060.4 holmes brothers promo :26
#061) an acoustic evening with the allman brothers band and the indigo girls
club r&r and epic cd promo: esk-4632
july 1992
recorded live at the radio and records convention,
los angeles, june 11, 1992
time: 69:02
-------------------------------------------------------------
#061.1 welcome me (live) 4:34 ar
#061.2 galileo (live) 4:34 es
#061.3 joking (live) 3:12 ar
#061.4 ghost (live) 5:27 es
#061.5 three hits (live) 3:40 ar
#061.6 closer to fine (live) 4:21 es
#061.7 the water is wide (live) 4:07 traditional
#061.8 come on in my kitchen (live) 5:27 [allman brothers]
#061.9 seven turns (live) 4:17 [allman brothers]
#061.10 midnight rider (live) 3:08 [allman brothers]
#061.11 southbound (live) 5:11 [allman brothers]
#061.12 in memory of elizabeth reed (l) 10:10 [allman brothers]
#061.13 goin' down the road (live) 5:39 [allman brothers]
#061.14 melissa (live) 5:02 [allman brothers]
#062) indigo girls live in san francisco
epic cs promo: <unnumbered>
fall 1992
recorded live at the great american music hall in san francisco,
california, august 24, 1992. comes in a "rites of passage" box,
but is a standard white label promo.
time:
-------------------------------------------------------------
#062.1 land of cannan (live) ar
#062.2 hammer & nail (live) es
#062.3 bartenders blues (live) j. taylor
#062.4 three hits (live) ar
#062.5 freebird (live) collins/van zant
#062.6 tangled up in blue (live) b. dylan
#062.7 welcome me (live)+ ar
#062.8 summertime (live)+ heyward/gershwin
#062.9 danny's song (live) loggins
#062.10 joking (live) ar
#062.11 the weakness in me (live) j. armatrading
-
#062.12 galileo (live) es
#062.13 the night they drove old dixie down(l)+ robertson
#062.14 chickenman (live) ar
#062.15 uncle john's band (live) hunter/garcia
#062.16 ghost (live) es
#062.17 down by the river (live) n. young
#062.18 love of the common people (live) hurley/wilkins
#062.19 finlandia (live) sibelius
+ with joan baez
#063) breaking curfew
epic cd promo: esk-7382
1995
identical to disc 1 of 1200 curfews (epic e2k 67229)
time: 71:21
-------------------------------------------------------------
#063.1 joking 4:26 ar
#063.2 least complicated 5:15 es
#063.3 thin line 4:21 gerard mchugh
#063.4 river 3:52 j. mitchell
#063.5 strange fire 5:13 ar
#063.6 power of two 5:16 es
#063.7 pushing the needle too far 4:20 ar
#063.8 virginia woolf 6:04 es
#063.9 jonas and ezekial 3:53 ar
#063.10 tangled up in blue 8:05 b. dylan
#063.11 world falls 3:52 ar
#063.12 bury my heart at wounded knee 5:07 b. saint-marie
#063.13 ghost 6:03 es
#063.14 dead man's hill 5:34 ar
#064) ep
epic cd promo: esk-41261
1998
time:
-------------------------------------------------------------
#064.1 shed your skin (morello remix) ar
#064.2 get out the map (live)+ es
#064.3 shame on you (live)++ ar
#064.4 everything in its own time (live)+++ es
#064.5 blister in the sun (live)++++
#064.6 shed your skin (live)+++++ ar
+ recorded aug 13, 1997, scranton, pa
++ recorded jan 29, 1998, santa barbara, ca
+++ recorded apr 27, 1997, 99x radio, atlanta
++++ recorded feb 1, 1998, la jolla, ca
+++++ recorded aug 20, 1997, shakopee, mn
>> cd singles/eps
#065) land of canaan
epic cd promo: esk-73003
1989
time: 3:56
-------------------------------------------------------------
#065.1 land of canaan+ 3:56 ar
+ from indigo girls (epic ek-45044)
#066) kid fears
epic cd promo: esk-1486
1989
time: 18:40
-------------------------------------------------------------
#066.1 kid fears+ 4:33 ar
#066.2 closer to fine+ 3:59 es
#066.3 center stage+ 4:46 ar
#066.4 prince of darkness+ 5:22 ar
+ from indigo girls (epic ek-45044)
#067) love's recovery
epic cd promo: esk-1490
1989
time: 12:28
-------------------------------------------------------------
#067.1 love's recovery+ 4:21 es
#067.2 secure yourself+ 3:34 ar
#067.3 kid fears+ 4:33 ar
+ from indigo girls (epic ek-45044)
#068) closer to fine
epic cd promo: esk-1634
1990
time: 3:59
-------------------------------------------------------------
#068.1 closer to fine+ 3:59 es
+ from indigo girls (epic ek-45044)
#069) closer to fine
epic cd promo: esk-1635
1990
time:
-------------------------------------------------------------
#069.1 closer to fine+ 3:59 es
#069.2 ???
+ from indigo girls (epic ek-45044)
#070) holiday greetings
epic cd promo: esk-1939
1989
third track is unlisted.
time: 7:35
-------------------------------------------------------------
#070.1 holiday greetings 0:18
#070.2 get together+ 3:33 c. powers
#070.3 holiday greetings/get together 3:44 c. powers
+ from strange fire (epic ek-45427)
#071) get together
epic cd promo: esk-73255
1990
time: 3:31
-------------------------------------------------------------
#071.2 get together+ 3:33 c. powers
#072) hammer and a nail
epic cd promo: esk-2200
1990
time: 3:48
-------------------------------------------------------------
#072.1 hammer and a nail+ 3:48 es
+ from nomads*indians*saints (epic ek-46820)
#073) watershed
epic cd promo: esk-2284
1990
time: 17:40
-------------------------------------------------------------
#073.1 watershed+ 5:44 es
#073.2 watershed (live)++ 5:32 es
#073.3 all along the watchtower (l)+++ 6:24 b. dylan
+ from nomads*indians*saints (epic ek-46820)
++ recorded live in austin, tx, 11/8/90
+++ from live at the uptown lounge (cbs 19v-49029)
#074) galileo
epic cd promo: esk-4434
1992 cd promo: esk-74326
available in both digi-pak and jewel box.
time: 4:12
-------------------------------------------------------------
#074.1 galileo+ 4:12 es
+ from rites of passage (epic ek-48865)
#075) joking
epic cd promo: esk-4550
1992
time: 3:33
-------------------------------------------------------------
#075.1 joking+ 3:33 ar
+ from rites of passage (epic ek-48865)
#076) ghost
cbs/epic cd promo: esk-4863
1993
plain white cd, no liner notes.
time: 4:55
-------------------------------------------------------------
#076.1 ghost+ 4:55 es
+ special radio edit from rites of passage (epic ek-48865)
#077) three hits
cbs/epic cd promo: esk-4864
1993
time: 20:15
-------------------------------------------------------------
#077.1 three hits+ 3:10 ar
#077.2 galileo (live) 4:12 es
#077.3 joking (live) 3:33 ar
#077.4 ghost (live) 5:13 es
#077.5 jonas and ezekial (live) 4:07 ar
+ from rites of passage (epic ek-48865)
#078) i don't wanna talk about it
epic soundtrax cd promo: esk-5657
1994
time: 3:37
-------------------------------------------------------------
#078.1 i don't wanna talk about it 3:37 danny whitten
+ from philadelphia soundtrack (epic soundtrax 57624)
#079) i don't wanna talk about it (holland)
epic soundtrax cd promo: epc 660209 1
1994
time: 12:17
-------------------------------------------------------------
#079.1 i don't wanna talk about it 3:37 danny whitten
#079.2 galileo (live)++ 4:44 es
+ from philadelphia soundtrack (epic soundtrax 57624)
++ recorded live at the fox theater, atlanta, 11/27/92
#080) i don't wanna talk about it (holland)
epic soundtrax cd promo: epc 660209 2
1994
time: 12:17
-------------------------------------------------------------
#080.1 i don't wanna talk about it 3:37 danny whitten
#080.2 galileo (live)++ 4:44 es
#080.3 jonas and ezekial (live)++ 3:56 ar
+ from philadelphia soundtrack (epic soundtrax 57624)
++ recorded live at the fox theater, atlanta, 11/27/92
#081) touch me fall
epic cd promo: esk-6029
1994
two versions:
- plain white cd, no liner notes.
- picture disc.
time: 4:45
-------------------------------------------------------------
#081.1 touch me fall+ 4:45 ar
+ special version
#082) least complicated
epic cd promo: esk-6081
1994
picture disc.
time: 4:13
-------------------------------------------------------------
#082.1 least complicated+ 4:13 es
+ from swamp ophelia (epic ek-57621)
#083) reunion (us promo)
epic cd promo: ek-6528
1994
time: 3:27
-------------------------------------------------------------
#083.1 reunion+ 3:27 ar
+ from swamp ophelia (epic ek-57621)
#084) power of two (us promo)
epic cd promo: esk-6886
1995
time: 4:50
-------------------------------------------------------------
#084.1 power of two+ 4:50 es
+ edit from swamp ophelia (epic ek-57621)
#085) closer to fine (uk promo)
epic cd promo: xpcd 653
1995
time: 3:59
-------------------------------------------------------------
#085.1 closer to fine 3:59 es
#086) bury my heart at wounded knee
epic cd promo: esk 7375
october 1995
time:
-------------------------------------------------------------
#086.1 bury my heart at wounded knee b. saint-marie
#086.2 thin line (live)+ gerard mchugh
#086.3 bury my heart at wounded knee (l)++ b. saint-marie
+ radio edit from 1200 curfews (epic e2k 67229)
++ from 1200 curfews (epic e2k 67229)
#087) shame on you
epic cd promo: esk 9709
april 1997
time: 7:43
-------------------------------------------------------------
#087.1 shame on you+ 3:42 ar
#087.2 shame on you++ 4:01 ar
+ radio edit from shaming of the sun (epic ek-67891)
++ from shaming of the sun (epic ek-67891)
#088) get out the map
epic cd promo: esk 0970
1997
time: 3:23
-------------------------------------------------------------
#088.1 get out the map+ 3:23 es
+ from shaming of the sun (epic ek-67891)
#089) shed your skin
epic cd promo: esk-41107
1998
time:
-------------------------------------------------------------
#089.1 shed your skin+ 4:11 ar
#089.2 shed your skin (live) ar
#089.3 shed your skin (morello remix)++ ar
#089.4 get out the map (live) es
#089.5 shame on you (live) ar
+ from shaming of the sun (epic ek-67891)
++ from ep (epic esk-41261)
>> vinyl singles/eps
#090) closer to fine
epic vinyl promo: zss 68912a
1989
time: 7:58
-------------------------------------------------------------
#090.1 closer to fine+ 3:59 es
-
#090.2 closer to fine+ 3:59 es
+ from indigo girls (epic ek-45044)
#091) closer to fine
epic vinyl 12" promo: eas-1481
1989
time: 18:00
-------------------------------------------------------------
#091.1 closer to fine+ 3:59 es
#091.2 prince of darkness+ 5:22 es
-
#091.3 center stage+ 4:46 ar
#091.4 kid fears+ 4:33 ar
+ from indigo girls (epic ek-45044)
#092) land of canaan plus five live
epic vinyl 12" promo: eas-1861
1989
time:
-------------------------------------------------------------
#092.1 land of canaan (studio)+ 3:55 ar
#092.2 crazy game (live)++ 3:09 es
#092.3 love of the common people (l)++ 3:22 j. hurley/r. wilkens
#092.4 mona lisas and mad hatters (l)++ 5:36 e. john/b. taupin
#092.5 secure yourself (live) 3:42 ar
#092.6 kid fears (live) ar
+ from indigo girls (epic ek-45044)
++ from reverse 1 - live (epic esk-1670)
#093) indigo girls live
epic vinyl 12" promo: aed-2287
1990
all tracks identical to shades of indigo (epic esk-2201).
recorded live at the paramount theater, denver, co,
october 21-22, 1990.
time: 51:44
-------------------------------------------------------------
#093.1 hammer and a nail (live) 3:45 es
#093.2 melissa (live) 4:30 g. allman/s. alaimo
#093.3 watershed (live) 5:33 es
#093.4 pushing the needle too far (l) 4:07 ar
#093.5 you and me of the 10,000 wars(l) 4:16 es
#093.6 daddy's all gone (live) 3:41 j. taylor
-
b side is identical
#094) shed your skin (dance mixes)
epic vinyl 12" promo: eas-41374
1998
four mixes of shed your skin.
time: 51:44
-------------------------------------------------------------
#094.1 stephen nikolas club mix 9:03 ar
#094.2 a.d.s. skinless mix (110 bpm) 6:44 ar
-
#094.3 stephen nikolas dub mix 9:13 ar
#094.4 a.d.s. ascension mix (125 bpm) 9:07 ar
>> cassettes
#095) land of canaan
epic cs single promo: zss 68912a
1989
both sides are identical.
time:
-------------------------------------------------------------
#095.1 land of canaan+ ar
+ edit from indigo girls (epic ek-45044)
#096) epic audio buyways 503
epic cs promo: eat 3008
1991
time:
-------------------------------------------------------------
#096. 1 2 3 (live)+ 4:30 ar/ejs
#096. tried to be true (live)+ 2:56 ar
+ from back on the bus, y'all (epic ek-47508)
#097) epic audio buyways 505
epic cs promo: eat 3009
1991
time:
-------------------------------------------------------------
#097. 1 2 3 (live)+ 4:30 ar/ejs
#097. prince of darkness (live)+ 6:01 es
+ from back on the bus, y'all (epic ek-47508)
#098) scholastic sampler
scholastic
special sampler in support of scholastic magazine ig contest.
time:
-------------------------------------------------------------
#098.1 (songwriting discussion) ar/es
#098.2 galileo+ 4:12 es
#098.3 kid fears++ 4:33 ar
#098.4 closer to fine++ 3:59 es
#098.5 virginia woolf+ 5:25 es
#098.6 dead man's hill+++ ar
#098.7 hammer and a nail++++ 3:51 es
#098.8 cut it out+++++ 3:53 ar
+ from rites of passage (epic ek-48865)
++ from indigo girls (epic ek-45044)
+++ from swamp ophelia (epic ek-57621)
++++ from nomads*indians*saints (epic ek-46820)
+++++ from shaming of the sun (epic ek-67891)
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 20:33:35 -0400
reply-to: neil <neily@netreach.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neil <neily@netreach.net>
subject: discography v
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
> videos
#147) indigo girls: live at the uptown lounge
cbs music video enterprises video: 19v-49029
january 9, 1990
available on vhs hi-fi and videodisc.
interviews are interspersed.
recorded live at the uptown lounge (really!), athens, ga,
august 31, 1989.
time: 68:00
-------------------------------------------------------------
#147.1 closer to fine (live) 3:50 es
#147.2 secure yourself (live) 3:29 ar
#147.3 land of canaan (live) 3:36 ar
#147.4 blood and fire (live) 4:28 ar
#147.5 strange fire (live) 5:30 ar
#147.6 prince of darkness (live) 5:23 es
#147.7 crazy game (live) 3:19 es
#147.8 kid fears (live)+ 4:38 ar
#147.9 welcome me (live) 4:08 ar
#147.10 love's recovery (live) 4:33 es
#147.11 get together (live) 3:10 c. powers
#147.12 all along the watchtower (live) 5:56 b. dylan
+ featuring guest vocal by michael stipe
#148) watershed
cbs music video enterprises (?) video:
october 10, 1995 dvd:
includes full-length videos, clips, early concert footage,
tv appearances, and behind-the-scenes footage from life on
the road. sequence is probably wrong.
time: about 60:00
-------------------------------------------------------------
#148. closer to fine es
#148. hammer and a nail es
#148. galileo es
#148. joking ar
#148. touch me fall ar
#148. least complicated es
#148. power of two es
#148. eensie weensie spider traditional (?)
#148. reunion (clip) ar
#148. chickenman (clip) ar
#148. get together (clip) c. powers
#148. finlandia (clip) sibelius
#148. southland in the springtime (clip) es
#149) a video yearbook
sony/epic (?) video promo:
1997
includes highlights from records, videos, tours, plus shaming of
the sun sessions.
time: about 10:00
-------------------------------------------------------------
> crazy, over-the-edge novelty releases (or: merchandising)
#150) screensaver: touch me fall
epic pc/mac: ess 61115
september 5, 1995
#150.1 touch me fall+ 4:46 ar
+ from swamp ophelia (epic ek-57621)
> guest appearances
#151) caroline aiken: live in the attic
glutton for publishment cd: no number
1993
#151.9 white house blues: vox (ar, es), guitar (es)
#151.10 another on the rise: vox & guitar (es)
#152) joan baez: ring them bells
guardian records cd: 34989
september 26, 1995
#152.13 don't think twice, it's alright: vox, guitar (ar, es)
#153) big fish ensemble: i hate parties
long play cd: lp25
1993
#153.2 animals: vox (ar, es)
#154) big fish ensemble: lucky
long play cd: lp34
#154.10 city of sin: vox (ar, es)
#155) billy pilgrim: billy pilgrim
atlantic cd: 82515-2
1994
#155.2 insomniac: vox (es)
#156) can we go higher
rockworld cd: 33 k 74808
1992
ig are among the artists on this collaborative benefit disc.
#156.1 can we go higher 6:23
#156.2 almost there 3:20
#156.3 can we go higher (edit) 3:59
#157) mary-chapin carpenter: come on come on
columbia cd: ck 48880
1992
#157.1 the hard way: vox (ar, es)
#157.10 walking through fire: vox (ar, es)
#158) catbird seat: fairy tales and songs
sister ruby records cd: sis 015
1995 (?)
#158.? that's life for the dreamer: vox (es)
#158.? falling: vox (es)
#159) disappear fear: disappear fear
philo cd: cd ph 1171
may 1994
#159.1 washington work song: vox (ar/es)
#159.5 be the one: vox (es)
#159.7 moment of glory: vox (ar)
#160) ellen james society: reluctantly we
daemon cd: dr01-2
1990
#160.10 motive: vox (ar)
#160.12 god in heaven: vox (ar), guitar (es)
#161) ferron: phantom center
??? cd: ???
1995
reissue of chameleon d2-74830, 1990
#161.? ???: vox (ar, es)
#162) ferron: still riot
??? cd: ???
1996
#162.? primitive future: vox (es)
#162.? <several others>: vox (es)
#163) nanci griffith: other voices, other rooms
elektra cd: 9-61464-2
1993
#163.17 wimoweh: vox (ar, es)
#164) nanci griffith: flyer
elektra cd: 9-61681-2
1994
#164.?? these days in an open book: vox (ar, es)
#164.?? time of inconvenience: vox (ar, es)
#165) kristen hall: real life stuff
daemon cd: 7-5055-2
1990
#165.2 it's alright: guitar & vox (es)
#165.11 fade away blind: guitar & vox (es)
#166) kristen hall: fact and fiction
daemon cd: 7-5053-2
1991
high street cd: 10316-2
1993 (?)
#166.3 i gave everything: guitar & vox (es)
#166.6 out in the country: guitar (es)
#166.?? wish i may: guitar & vox (es)
#167) kristen hall: be careful what you wish for ...
high street cd: 10326-2
1994
#167.6 following my compass: guitar & vox (es)
#168) james hall band: my love, sex and spirit
daemon cd: 19001-2
1993
#168.10 madness is a numbered face: vox (ar)
#169) kodac harrison: the heart of the soul
??? cd: ???
1993
#169.?? (several): guitar (es)
#170) k's choice: ???
550 music/epic cd promo: bsk-6888
1995
#170.5 rockin' in the free world (l)+ 4:45 n. young
+ same version as ig power of two single (epic 34k 77844)
#171) michelle malone and drag the river: relentless
arista cd: arcd-8630
1990
#171.?? long love century: vox (ar)
#172) gerard mchugh: more than i
daemon cd: 7-5052-2
1992
#172.7 love is a lion: acoustic guitars & vox (ar, es)
#173) kris mckay: what love endures
arista vinyl: al-8586
1990
#173.1 one moment to another: vox (ar, es)
#173.2 any single solitary heart: vox (ar, es)
#174) janet mclaughlin: dancing
muddy paws cd: <unnumbered>
november 1994
#174.1 solid ground: vox (ar, es)
#175) mrs. fun: ennui
lulu cd: lulu 004
april 1995
#175.? gossip: vox (ar, es)
#176) new mongrels: not dead (yet)
daemon cd: 19004-2
april 1994 vinyl: dr-19004-1
hand drawn cover
#177) new mongrels: big cup of empty
daemon cd: ???
march 1998
#177.?? guy lombardo: vox (ar)
#177.?? shooting from the sky: vox (es)
#178) the oblivious: ???
daemon cd: ???
1993
#178.? sleep: vox (ar)
#179) vonda shepard: by 7:30
jacket cd: ???
1999
#179.? baby, don't you break my heart slow: vox (es)
#180) matthew sweet: goodfriend (another take on "girlfriend")
zoo entertainment/bmg music cd promo: zp 17098/2
1992
#180.12 cortez the killer (live): guitars & vox (ar, es)
#181) dwight yoakum: if there was a way
??? cd: 9-26344-2
???
#181.14 let's work together: vox (ar, es)
> other information
>> internet mailing list
there is an internet mailing list devoted to the indigo girls and other
related (mostly atlanta-based) artists. to subscribe (or unsubscribe),
send a message to:
listserv@netspace.org
messages sent to:
indigo-girls@netspace.org
are *automatically* sent to all subscribers of the list. *please do
not send administrative requests to this address!*
>> usenet newsgroup
there is a usenet newsgroup dedicated to indigo girls,
rec.music.indigo-girls.
>> official fan club
the official indigo girls fan club can be reached care of their
manager, russell carter, at:
indigo girls fan club
c/o russell carter
suite 755
315 w. ponce de leon ave.
decatur, ga 30030
(404) 377-9900
(404) 377-5131 fax
this is also the place to contact for tour information and to order
indigo girls t-shirts, song books, bumper stickers, etc.
>> birthdays
amy elizabeth ray b. 4-12-1964 atlanta, ga
emily ann saliers b. 7-22-1963 new haven, ct
> author and acknowledgements
this discography has been compiled by steve clark (sclark@cen.com) from
personal experience and from messages on the internet indigo girls
electronic mailing list (see above). please send corrections or
additions to the the new owner, neil hunt (neily@netreach.net)
a very early discography posted to the mailing list (probably in late
1990) formed the original basis; i'm afraid i don't remember who wrote
it. if somebody knows, i'd be glad to hear. i certainly couldn't
have written this without the help of list subscribers far too
numerous to mention here; really, it's gotten to the point where i'm
afraid to include a list for fear of leaving somebody out. you know
who you are, and i thank you.
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 20:36:30 -0400
reply-to: neil <neily@netreach.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neil <neily@netreach.net>
subject: discography iv - a
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
> sampler appearances
#098) the best of mountain stage, volume 5
blue plate music cd: bpm-005cd
may 1993
time:
-------------------------------------------------------------
#098.1 angels [peter holsapple and
chris stamey]
#098.2 early summer rain [kevin welch]
#098.3 walkin for your love [widespread panic]
#098.4 particle man [they might be giants]
#098.5 peace [los lobos]
#098.6 love's recovery (live) indigo girls (es)
#098.7 responsibility [steve forbert]
#098.8 goodnite irene [pere ubu]
#098.9 any cure [subdudes]
#098.10 rockin' the res [john trudell]
#099) boys on the side (soundtrack)
arista cd: ???
january 1994
time:
-------------------------------------------------------------
#099.1 you got it 3:25 [bonnie raitt (orbison)]
#099.2 i take you with me 4:48 [melissa etheridge]
#099.3 keep on growing 5:24 [sheryl crow
(clapton/whitlock)]
#099.4 power of two 5:22 indigo girls (es)
#099.5 somebody stand by me 5:05 [stevie nicks (crow/wolf)]
#099.6 everyday is like sunday 3:41 [the pretenders (morrissey)]
#099.7 dreams 4:30 [the cranberries]
#099.8 why 4:53 [annie lennox]
#099.9 ol' 55 4:11 [sarah mclachlan (waits)]
#099.10 willow 4:01 [joan armatrading]
#099.11 crossroads 2:49 [jonell mosser (johnson)]
#099.12 you got it 3:08 [whoopi goldberg (orbison)]
#099.13 you got it 3:25 [bonnie raitt (orbison)]
#100) burning london: the clash tribute
epic cd: ek69106
1999
time:
-------------------------------------------------------------
#100.1 hateful [no doubt]
#100.2 this is radio clash [the urge]
#100.3 should i stay or should i go [ice cube and mack 10]
#100.4 cheat [rancid]
#100.5 train in vain [third eye blind]
#100.6 clampdown indigo girls
#100.7 rudie can't fail [the mighty mighty bosstones]
#100.8 white man in hammersmith palais [311]
#100.9 lost in the supermarket [afghan whigs]
#100.10 white riot [cracker]
#100.11 london's burning [silverchair]
#100.12 straight to hell [moby featuring heather nova]
#101) captured live on the mountain, volume 2
the mountain cd: kmjt-0295-2
1995
radio station sampler of in-studio cuts.
time:
-------------------------------------------------------------
#101.1 power of two (live)+ indigo girls (es)
+ recorded 8/17/94
#102) cbs radio sampler
cbs cd: crsk-0005
1989
time:
-------------------------------------------------------------
#102.1 get together+ 3:31 indigo girls (c. powers)
+ from strange fire (epic ek-45427)
#103) certain damage! #15
cmj cd promo: cd-015
february 1989
time: 65:10
-------------------------------------------------------------
#103.1 kid fears+ 4:33 indigo girls (ar)
#103.2 madonna of the wasps [robyn hitchcock and
the egyptians]
#103.3 hope of the hour [dharma bums]
#103.4 fun and games [connells]
#103.5 never again [zulus]
#103.6 einstein [keith leblanc]
#103.7 celestial cornerstone [black sun ensemble]
#103.8 feed me with your kiss [my bloody valentine]
#103.9 right now [flaming lips]
#103.10 hard core [radiators]
#103.11 in our time [wild history]
#103.12 hemingway [blue cocks green]
#103.13 the rain [laughing matter]
#103.14 judgement day [social act]
#103.15 slipping away [defcon]
#103.16 rainbow bar and girls [black and white]
+ from indigo girls (epic ek-45044)
#104) certain damage! #56
cmj cd promo: cd-056
april 1994
time:
-------------------------------------------------------------
#104.3 touch me fall+ 4:45 ar
+ special version from touch me fall promo single (epic esk-6029)
#105) cities' sampler - gems volume 6
rl cd: ktczvol6
december 1994
twin cities radio compilation.
time: 74:50
-------------------------------------------------------------
#105.2 three hits 2:53 indigo girls (ar)
#106) deadicated
arista cd: arcd-8669 *
april 1991 cs: ac-8669 *
* schwann p. 251 uk cd: qp 354179
grateful dead tribute album
time: 74:50
-------------------------------------------------------------
#106.1 bertha 5:17 [los lobos]
#106.2 jack straw 5:51 [bruve hornsby & the range]
#106.3 u.s. blues 5:18 [the harshed mellows]
#106.4 ship of fools 5:20 [elvis costello]
#106.5 china doll 3:25 [suzanne vega]
#106.6 cassidy 3:34 [suzanne vega]
#106.7 truckin' 5:25 [dwight yoakam]
#106.8 casey jones 4:16 [w. zevon w/ david lindley]
#106.9 uncle john's band 4:48 indigo girls
#106.10 friend of the devil 4:14 [lyle lovett]
#106.11 to lay me down 5:18 [cowboy junkies]
#106.12 wharf rat 6:05 [midnight oil]
#106.13 estimated prophet 6:46 [burning spear]
#106.14 deal 4:17 [dr. john]
#106.15 ripple 4:39 [jane's addiction]
#107) don't eat out of dented cans
radio records vinyl: #002
1987
wrfg, atlanta compilation of local artists.
time:
-------------------------------------------------------------
#107.1 just the other day i [craig rafuse]
#107.2 prince charming [joyce brookshire]
#107.3 mirror of truth [elise witt and the
small family orchestra]
#107.4 ballad of jesse lee [becca kahn]
#107.5 don't give up on me baby 3:16 indigo girls (es)
-
#107.6 aragon mill [elise witt and the
small family orchestra]
#107.7 america the free [lenny berger]
#107.8 walk away 5:32 indigo girls (ar)
#107.9 i ain't got nothing to do [adamantly egalitarian
with nobody string and reed corps]
#107.10 second fiddle [joyce brookshire]
#108) generation next
sony music special productions cd: ab 23207
late 1992
promo for the bon marche
time:
-------------------------------------------------------------
#108.1 where does my heart beat now [celine dion]
#108.2 shower me with your love [surface]
#108.3 love...thy will be done [martika]
#108.4 closer to fine+ 3:59 indigo girls (es)
#108.5 cult of personality [living colour]
#108.6 pride and joy [stevie ray vaughn]
#108.7 let the beat hit'em [lisa lisa & cult jam]
#108.8 get on your feet [gloria estefan]
#108.9 power of love [luther vandross]
#108.10 don't be cruel [cheap trick]
+ from indigo girls (epic ek-45044)
#109) hitchhiker exampler
columbia records cd: ck-46036 [add] *
march 1990 cs: ct-46036 *
* schwann p. 524
time: 41:34
-------------------------------------------------------------
#109.1 the faith is mine [rodney crowell]
#109.2 this shirt [mcc]
#109.3 2000 years [darden smith]
#109.4 i don't have to crawl [rosanne cash]
#109.5 make it easier+ 4:00 indigo girls (es)
#109.6 tell me the truth [rodney crowell]
#109.7 the better to love you [the o'kanes]
#109.8 something to believe in [shawn colvin]
#109.9 never let a day go by [darden smith]
#109.10 read my lips [mcc]
#109.11 talkin' at the texaco [james mcmurtry]
+ from strange fire (epic ek-45427)
#110) hitchhiker exampler 2
columbia records cd: ck-47321 *
april 1991 cs: cs-47321 *
* schwann p. 260
time: 47:53
-------------------------------------------------------------
#110.1 down at the twist and shout [mcc]
#110.2 midnight train [darden smith]
#110.3 stay (don't be cruel) [rodney crowell]
#110.4 poor boy blues [chet atkins/mark knopfler]
#110.5 all come true [rosanne cash]
#110.6 you're gonna make me lonesome [shawn colvin]
when you go (live)
#110.7 cadillac avenue [don henry]
#110.8 southland in the springtime+ 4:20 indigo girls (es)
#110.9 molasses [radiators]
#110.10 when she's gone [mcc]
#110.11 white house keys [don henry]
#110.12 i want a cure [rosanne cash]
#110.13 didn't want to sing the blues [tommy crowell and
the young ramblers]
+ from nomads*indians*saints (epic ek-46820)
#111) the hitchhiker radio hour - saga 2
columbia records cd promo: ???
1989 vinyl promo: ???
hosted by mcc, with interviews of all but indigo girls.
time: 56:13
-------------------------------------------------------------
#111.1 never had it so good [mcc]
#111.2 ditty, ditty (all night long) [the o'kanes]
#111.3 careless love [the o'kanes w/mcc]
#111.4 rosie strike back [rosanne cash]
#111.5 runaway train [rosanne cash]
#111.6 707 [rosanne cash]
#111.7 quittin' time [mcc]
#111.8 cry like an angel [shawn colvin]
#111.9 poor lost soul [james mcmurtry]
#111.10 i'm not from here [james mcmurtry]
#111.11 too long in the wasteland [james mcmurtry]
#111.12 crazy baby [rodney crowell]
#111.13 she's crazy for leavin' [rodney crowell]
#111.14 hey backwoods [rodney crowell]
#111.15 i don't wanna know+ 3:35 indigo girls (mm/ar)
+ from strange fire (epic ek-45427), with audience noise added
#112) hitchhiker radio saga 3
columbia records cd: ask-3033
1991
each track is preceded by interview/conversation.
includes a track of program promos by the artists.
time: 62:38
-------------------------------------------------------------
#112.1 down at the twist and shout [mcc]
#112.2 midnight train [darden smith]
#112.3 you're gonna make me lonesome [shawn colvin]
when you go+
#112.4 southland in the springtime++ 4:20 indigo girls (es)
#112.5 stay (donn't be cruel) [rodney crowell]
#112.6 poor boy blues [chet atkins/mark knopfler]
#112.7 i want a cure [rosanne cash]
#112.8 white house keys [don henry]
#112.9 molasses [radiators]
#112.10 didn't want to sing the blues [tommy conwell and the
young ramblers]
+ no interview
++ from nomads*indians*saints (epic ek-46820); interview from shades
of indigo (epic esk-2201)
#113) hitchhiker sampler 2
columbia records cd: ask-1878
1990
time: 39:54
-------------------------------------------------------------
#113.1 quittin' time [mcc]
#113.2 poor lost soul [james mcmurtry]
#113.3 cry like an angel [shawn colvin]
#113.4 707 [rosanne cash]
#113.5 ditty, ditty (all night long) [the o'kanes]
#113.6 diamond in the rough [shawn colvin]
#113.7 many a long and lonesome highway [rodney crowell]
#113.8 i don't wanna know+ 3:17 indigo girls (mm/ar)
#113.9 too long in the wasteland [james mcmurtry]
#113.10 goodbye again [mcc]
+ from strange fire (epic ek-45427)
#114) honor: a benefit for the honor the earth campaign
daemon 1996 cd: 19012-2
2 disc set
time: 17:13
-------------------------------------------------------------
#114.1 all my relations [ulali]
#114.2 crazy life [toad the wet sprocket]
#114.3 wise users [bruce cockburn]
#114.4 the future is a war [exene cervenka]
#114.5 things we do [indigenous]
#114.6 bury my heart at wounded knee [luka bloom]
#114.7 my mother is not the white dove [jane siberry]
#114.8 4r ancestors [keith secola & wild band
of indians]
#114.9 scattered [rusted root]
#114.10 wounded knee [reversing hour]
-
#114.11 home [bonnie raitt & david grisman]
#114.12 out of the blues [john trudell]
#114.13 21st century man [victoria williams]
#114.14 wake up dolores [latin playboys]
#114.15 motel notell [soul asylum]
#114.16 small world [sherman alexie & jim boyd]
#114.17 one knee gospel [frank hyde & mike jones]
#114.18 blood quantum indigo girls (ar/es)
#114.19 a day in the life of a tree [matthew sweet]
#114.20 creation story [joy harjo & poetic justice]
#114.21 oil, arms, and drugs [ulali]
#115) in your ear
cbs promo cd3: csig 000261
1989
time: 17:13
-------------------------------------------------------------
#115.1 cult of personality 4:53 [living colour]
#115.2 tribute (right on) 4:20 [the pasadenas]
#115.3 voice of babylon 3:27 [the outfield]
#115.4 kid fears+ 4:33 indigo girls (ar)
+ from indigo girls (epic ek-45044)
#116) kbco: the best of studio c volume 2
kbco radio cd: kbco-c-02
december 1992
kbco, boulder compilation of radio studio appearances.
time: 64:18
-------------------------------------------------------------
#116.1 kit carson 3:47 [bruce cockburn]
#116.2 what are we gonna do? 4:19 [dramarama]
#116.3 happy phantom 3:31 [tori amos]
#116.4 johnny & mary 4:36 [big shoulders]
#116.5 leap of faith 4:37 [kenny loggins]
#116.6 don't worry about yourself 4:35 [liz barnez band]
#116.7 saltwater 3:40 [julian lennon]
#116.8 take me home 5:20 [sun-60]
#116.9 alfalfa's 3:13 [leftover salmon]
#116.10 back to bayou tech 4:58 [sonny landreth & steve conn]
#116.11 jonas & ezekial+ 3:45 indigo girls (ar)
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
#116.12 waiting 4:30 [the orgin]
#116.13 candyland 3:42 [james mcmurty & friends]
#116.14 girlfriend 2:37 [matthew sweet]
#116.15 what's it all about 5:45 [western vogue]
#116.16 happy boy 1:23 [beat farmers]
+ recorded july 1992
#117) kbco: the best of studio c volume 9
kbco radio cd: kbco-c-09
december 1997
kbco, boulder compilation of radio studio appearances.
benefit for boulder county aids project
time:
-------------------------------------------------------------
#117.1 whatever i fear [toad the wet sprocket]
#117.2 shame on you indigo girls (ar)
#117.3 all for you [sister hazel]
#117.4 home [sheryl crow]
#117.5 please don't tell her [big head todd & the monsters]
#117.6 you can leave your hat on [randy newman]
#117.7 is it like today [world party]
#117.8 criminal [fiona apple]
#117.9 barely breathing [duncan sheik]
#117.10 the mountains win again [blues traveler]
#117.11 delta rain [william topley]
#117.12 wonder [freddy jones band]
#117.13 eye of the hurrican [david wilcox]
#117.14 four leaf clover [abra moore]
#117.15 flood [jars of clay]
#117.16 aunt avis [widespread panic]
#118) live at the world cafe, vol. 1
wxpn radio cd: ???
1995
live in-studio appearances from world cafe.
time:
-------------------------------------------------------------
#118.1 i'm the only one [melissa etheridge]
#118.2 and she was [david byrne]
#118.3 leaving las vegas [sheryl crow]
#118.4 it's so hard [the subdudes]
#118.5 least complicated indigo girls (es)
#118.6 beeswing [richard thompson]
#118.7 feed the fire [happy rhodes]
#118.8 long tall cool one [bruce hornsby]
#118.9 so much mine [the story]
#118.10 rain king [counting crows]
#118.11 silent all these years [tori amos]
#118.12 woman with the strength of 10,000 men [peter himmelman]
#118.13 the bonny swans [loreena mckennitt]
#118.14 anna lee [sonia dada]
#118.15 baby, i can't please you [sam phillips]
#118.16 blue [the jayhawks]
#118.17 anniversary song [cowboy junkies]
#119) live from the music hall, vol. ii
ksca (los angeles) cd: ???
may 24, 1996
in-studio radio performances, except as noted.
time:
-------------------------------------------------------------
#119.1 st. teresa [joan osborne]
#119.2 ain't no brakeman [john mayall]
#119.3 come a long way [michelle shocked]
#119.4 lawyers, guns and money [warren zevon]
#119.5 honey don't think [grant lee buffalo]
#119.6 everything falls apart [dog's eye view]
#119.7 stay (i missed you) [lisa loeb]
#119.8 cry love+ [john hiatt]
#119.9 the valley road [bruce hornsby]
#119.10 i kissed a girl [jill sobule]
#119.11 we're the same [matthew sweet]
#119.12 reunion indigo girls (ar)
#119.13 if you love me (why am i dying) [boxing ghandis]
#119.14 fear of falling [the badlees]
#119.15 shapes and sizes [joan armatrading]
#119.16 my father's son [dillon o'brien]
#119.17 spark [the wild colonials]
#119.18 the future's so bright, i gotta [timbuk 3]
wear shades
+ recorded at starbuck's coffeehouse
#120) no boundaries: a benefit for the kosovar refugees
epic cd: ek 63653
1999
time:
-------------------------------------------------------------
#120.?? go+ indigo girls (ar)
+ recorded live at park west, chicago, 8/26/98
#121) not for sale
advanced alternative media cd: ???
1995
time:
-------------------------------------------------------------
#121.1 chickens don't have fingers [stuntman]
#121.2 cosmic dick [gwen mars]
#121.3 believe what you're saying [bob mould and lou barlow]
#121.4 lost highway [jeff buckley]
#121.5 away she went [all]
#121.6 cinderella backstreet [mary lou lord]
#121.7 dislike [juned]
#121.8 ride the tide [screamin' cheetah wheelis]
#121.9 pretty awful [magnapop]
#121.10 down by the river indigo girls (n. young)
#121.11 compadre [sage]
#121.12 wet dream [lords of acid]
#121.13 falling [bio hazard]
#121.14 free love [morphine]
#121.15 at a crawl [the melvins]
#121.16 tomorrow [blueberrie spy]
#122) 99x live x for humanity
99x/wnnx, atlanta cd: wnnx01
june 1994
most songs recorded live at the purple dragon recording
studio, atlanta.
time:
-------------------------------------------------------------
#122.1 believe [lenny kravitz]
#122.2 mmm mmm mmm mmm [crash test dummies]
#122.3 low [cracker]
#122.4 it's a shame about ray [evan dando]
#122.5 idaho [bodeans]
#122.6 divine intervention+ [matthew sweet]
#122.7 waiting for the sun [the jayhawks]
#122.8 creep [radiohead]
#122.9 down by the river indigo girls (n. young)
#122.10 felt so cool [adam schmitt]
#122.11 superman song [crash test dummies]
+ recorded live at the cabaret metro, chicago, april 18, 1993.
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 20:36:56 -0400
reply-to: neil <neily@netreach.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neil <neily@netreach.net>
subject: discography iv - b
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
#123) 99x live x iv
99x/wnnx, atlanta cd: wnnx04 (?)
june 1998
time:
-------------------------------------------------------------
#123.1 sunny came home [shawn colvin]
#123.2 open up your eyes [tonic]
#123.3 push [matchbox 20]
#123.4 sex & candy [marcy playground]
#123.5 song 2 [blur]
#123.6 not an addict [k's choice]
#123.7 try [michael penn]
#123.8 shame on you indigo girls (ar)
#123.9 dead man walking [david bowie]
#123.10 three marlenas [the wallflowers]
#123.11 hell [squirrel nut zippers]
#123.12 frank sinatra [cake]
#123.13 criminal [fiona apple]
#123.14 long, long time [love spit love]
#123.15 how's it going to be [third eye blind]
#123.16 is it like today [world party]
#123.17 home [sheryl crow]
#124) on the edge: show #94-34
??? cd: ???
1994
radio show, includes interview. for broadcast week of
august 15, 1994. track ids are educated guesses.
also features love spit love and l7.
time: 12:48
-------------------------------------------------------------
#124.1 galileo+ 4:12 es
#124.2 touch me fall++ 4:46 ar
#124.3 least complicated+++ 3:50 es
+ from rites of passage (epic ek-48865)
++ from swamp ophelia (epic ek-57621)
+++ special acoustic version
#125) out loud
knitting factory works cd: kfw 169
september 20, 1995
benefit for the international gay and lesbian human rights
commission.
time:
-------------------------------------------------------------
#125.1 taking a liking [melissa ferrick]
#125.2 this train (revised) (l)+ indigo girls (ar)
#125.3 michelangelo [disappear fear]
#125.4 sexuality [billy bragg]
#125.5 finished (l) [throwing muses]
#125.6 weddings are icky [girls in the nose]
#125.7 lucky star [the mekons]
#125.8 stumbling home [daniel cartier]
#125.9 i don't understand anything [everything but the girl]
#125.10 swim to me [the jazz passengers]
#125.11 tri-monk [the billy tipton memorial
saxophone quartet]
#125.12 my dead friend [the judybats]
#125.13 night and day [u2 (c. porter)]
#125.14 shave your head [voice farm]
#125.15 pease park [the gretchen phillips
experience]
#125.16 kiss my sticky (udderly romantic) [betty]
#125.17 my man, our horses, and me [y'all]
+ recorded 12/94 in london
#126) philadelphia (soundtrack)
epic soundtrax cd: 57624
january 4, 1994 uk cd: 474998 2
uk cs: 474998 4
time:
-------------------------------------------------------------
#126. philadelphia [neil young]
#126. streets of philadelphia [bruce springsteen]
#126. please send me someone to love [sade]
#126. i don't wanna talk about it indigo girls (danny whitten)
#126. lovetown [peter gabriel]
#126. have you ever seen the rain [spin doctors]
#127) pick this
epic/columbia/chaos cd: esk-4788
1992
time:
-------------------------------------------------------------
#127.1 somebody to shove [soul asylum]
#127.2 i don't sleep, i drink coffee instead [brenda kahn]
#127.3 dollar bill [screaming trees]
#127.4 humans from earth [t-bone burnett]
#127.5 does this hurt? [the boo radleys]
#127.6 chasing a bee [mercury rev]
#127.7 please yourself [darling buds]
#127.8 monster mouth [popinjays]
#127.9 ebeneezer goode [the shamen]
#127.10 hazy shade of criminal [public enemy]
#127.11 bombtrack [rage against the machine]
#127.12 state of love and trust [pearl jam]
#127.13 burst [shelleyan orphan]
#127.14 ghost indigo girls (es)
#127.15 beneath the damage and the dust [peter himmelman]
#127.16 if you don't love me [prefab sprout]
#127.17 i'll hate you better [suicidal tendencies]
#127.18 here it comes [mc serch]
#127.19 basket case [eon]
#127.20 white water [shona laing]
#128) putumayo presents: the best of folk music, contemporary folk
rhino cd: 71448
1993
time:
-------------------------------------------------------------
#128.1 past the point of rescue [mary black]
#128.2 irresistible targets [john stewart]
#128.3 hammer and a nail+ indigo girls (es)
#128.4 ireland [greg trooper]
#128.5 never go back [christine lavin]
#128.6 know when to move [john mccutcheon]
#128.7 play me backwards [joan baez]
#128.8 turning away [dougie mclean]
#128.9 out in the country [kristen hall]
#128.10 who woulda thunk it [greg brown]
#128.11 mine fields (from years to hours) [catie curtis]
#128.12 bb king was wrong [john gorka]
#128.13 my father's shoes [cliff eberhardt]
+ from nomads*indians*saints (epic ek-46820)
#129) put on your green shoes
sony kid's music cd: lk-53736
1993
an all-star album dedicated to healing the planet.
time: 45:59
-------------------------------------------------------------
#129.1 put on your green shoes 3:08 [3 cats 'n jammers (featuring
cyndi lauper, eric bazilian
& rob hyman)]
#129.2 the light of the sun 3:41 [richie havens with rockapella]
#129.3 wild, wild party in the loquat 3:01 indigo girls (rand bishop)
tree
#129.4 what a wonderful world 2:14 [willie nelson]
#129.5 singing river 2:50 [tom paxton]
#129.6 plant more than you harvest 3:39 [rory]
#129.7 where the world is wetter 2:49 [keven roth w/ amanda mcbroom]
#129.8 green shoes talk 1:55 [levar burton, linda gray,
martin sheen, bruce jenner]
#129.9 don't give my green shoes the 3:22 [john townsend &
blues the safe squad]
#129.10 take care of yourself 4:23 [dr. john]
#129.11 if you believe 4:05 [kenny loggins]
#129.12 the flower that shattered the 3:22 [olivia newton-john]
stone
#129.13 someone's gonna use it 2:43 [tom chapin]
#129.14 green shoes walk 4:47 [next issue with rappers]
#130) siren song: a celebration of women in music
epic cd: ek 66215
1996
#130.1 [celine dion]
#130.2 [des'ree]
#130.3 [cyndi lauper]
#130.4 [nicky holland]
#130.5 [beverley craven]
#130.6 [sade]
#130.7 [basia]
#130.8 closer to fine 3:59 indigo girls (es)
#130.9 [gloria estefan]
#130.10 [jennifer rush]
#131) spirit of '73 - rock for choice
epic cd: bk 66879
august 8, 1995
benefit for rock for choice.
other releases:
uk september 1995 cd: 480981 2
cs: 480981 4
time:
-------------------------------------------------------------
#131.1 if i can't have you [eve's plum (yvonne elliman)]
#131.2 more, more, more (pt. 1) [babes in toyland
(andrea true connection)]
#131.3 we are family [ebony vibe everlasting
(sister sledge)]
#131.4 dreams [letters to cleo
(fleetwood mac)]
#131.5 dancing barefoot [johnette napolitano
(p. smith)]
#131.6 cherry bomb [l7 w/joan jett (the runaways)]
#131.7 midnight at the oasis [that dog (m. muldaur)]
#131.8 have you never been mellow [pet (o. newton-john)]
#131.9 river [rosanne cash (j. mitchell)]
#131.10 feel like making love [melissa ferrick (r. flack)]
#131.11 killing me softly with his song [cassandra wilson]
#131.12 blue [sarah mclachlan (j. mitchell)]
#131.13 it won't take long indigo girls (ferron)
#131.14 the night they drove old dixie down [sophie b. hawkins (robertson)]
#132) sweet relief ii
columbia cd: ???
1996
vic chesnutt tribute.
time:
-------------------------------------------------------------
[r.e.m.]
[smashing pumpkins]
[soul asylum]
[live]
[cracker]
[garbage]
[dog's eye view]
[mary margaret o'hara]
[sparklehorse]
[kristin hersh]
indigo girls
[victoria williams and
vic chesnutt]
[nanci griffith w/hootie
and the blowfish]
[joe henry and madonna]
#133) tame yourself
rhino new artists cd: r2-70772 *
february 1991 cs: r4-70772 *
* schwann p. 276
tame yourself on lp
wea 9031-74745-1
also says "made in germany"
features a different cover (a big floppy dog with pink-tinted hair)
sponsored by people for the ethical treatment of animals.
time: 55:40
-------------------------------------------------------------
#133.1 don't be a part of it 4:19 [howard jones]
#133.2 tame yourself 4:14 [raw youth]
#133.3 i'll give you my skin 3:13 indigo girls and
michael stipe
#133.4 damned old dog 3:19 [k.d. lang]
#133.5 quiche lorraine (live) 4:27 [the b-52's]
#133.6 slaves 3:25 [fetchin bones]
#133.7 born for a purpose 3:30 [the pretenders]
#133.8 don't kill the animals ('91 mix) 4:45 [nina hagen & lene lovich]
#133.9 fur 3:40 [jane wiedlin]
#133.10 asleep too long 3:02 [the goosebumps]
#133.11 rage 4:54 [erasure & lene lovich]
#133.12 bless the beasts and the 4:16 [belinda carlisle]
children
#133.13 across the way 4:57 [aleka's attic]
#133.14 do what i have to do 2:56 [exene cervenka]
#134) theodore: an alternative music sampler
columbia records cd: ck-46082 *
april 1990 cs: ct-46062 *
* schwann p. 526
time:
-------------------------------------------------------------
#134.1 be kind to my mistakes [kate bush]
#134.2 bury me deep [poi dog pondering]
#134.3 she says [the rave-ups]
#134.4 let it be me [social distortion]
#134.5 talkin' 'bout a revolution (live) [living colour]
#134.6 come back down [toad the wet sprocket]
#134.7 overflow [o-positive]
#134.8 house [psychedelic furs]
#134.9 welcome to the terrordome [public enemy]
#134.10 if i were john carpenter [big audio dynamite]
#134.11 run through the fields [nuclear valdez]
#134.12 kid fears (live) indigo girls (ar)
#134.13 shotgun down the avalanche (live) [shawn colvin]
#134.14 another life [big dipper]
#134.15 triple stage darkness [3rd bass]
#134.16 your fear [prong]
#135) stanley: son of theodore: yet another alternative music sampler
epic cs: et-47304 *
march 1992 cd: ek-47304 *
* schwann p. 38
time:
-------------------------------------------------------------
#135.1 everybody's gone [senseless ways]
#135.2 kool-aid (british version) [big audio dynamite ii]
#135.3 make it mine (remix) [the shamen]
#135.4 love's sweet exile [manic street preachers]
#135.5 out of my head [sun-60]
#135.6 hand on the pump [cypress hill]
#135.7 alice (live) [pearl jam]
#135.8 fight the youth (remix) [fishbone]
#135.9 woodtop [shabba ranks]
#135.10 nighttrain (remix) [public enemy]
#135.11 venus in furs [eye & i]
#135.12 kit carson [bruce cockburn]
#135.13 pushing the needle too far (l)+ 4:07 indigo girls (ar)
#135.14 get me on [poi dog pondering]
#135.15 the truth [gregg alexander]
#135.16 it won't be long (acoustic) [alison moyet]
+ from shades of indigo (epic esk-2201)
#136) the times they are a-changin'
sister ruby records cd: sis 001
1991
bob dylan tribute album by atlanta artists
time: 46:12
-------------------------------------------------------------
#136.1 rainy day women #12 & 35 [david harris]
#136.2 stuck inside of mobile with the [catbird seat]
memphis blues again
#136.3 tangled up in blue 7:39 indigo girls with drag
the river
#136.4 buckets of rain [wendy bucklew]
#136.5 when the ship comes in [david franklin]
#136.6 i'll be your baby tonight [michelle malone]
#136.7 it ain't me babe [kristen hall]
#136.8 if you see her say hello [the ethel mertz experience]
#136.9 masters of war [kevin kinney]
#136.10 fourth time around [peter williams]
#136.11 you ain't goin' nowhere [feel like you]
#136.12 the times they are a-changin' [eddie owen]
#137) the times they are a-changin' - a tribute to bob dylan volume 3
sister ruby records cd: sis 020
1998
limited edition of 1500
time: ?
-------------------------------------------------------------
#137.1 i'll keep it with mine [greg trooper]
#137.2 hurricane [a film by billy wilder]
#137.3 she belongs to me [#1 family mover]
#137.4 ballad in plain d emily saliers
#137.5 tonight i'll be staying here with you [charlie chesterman]
#137.6 bob dylan's [eric taylor]
#137.7 the ballad of hollis brown [hootie and the blowfish]
#137.8 up to me [joseph arthur]
#137.9 boots of spanish leather [ida]
#137.10 isis [maryanne]
#137.11 senor (tales of yankee power) [the backyard swings]
#137.12 most likely you'll go your way [the vidalias]
(and i'll go mine)
#137.13 it's all over now baby blue [kelly hogan]
#138) totally excellent tunes - lazarus
epic cd: ???
1989?
time:
-------------------------------------------------------------
#138.? closer to fine+ 3:59 indigo girls (es)
+ from indigo girls (epic ek-45044)
#139) tune-up #57
album network cd promo: ???
october 1990
time: 64:58
-------------------------------------------------------------
#139.1 the road [the alarm]
#139.2 mama help me [edie brickell]
#139.3 it's love [king's x]
#139.4 battle him republican [michelle malone]
#139.5 my ship [company of wolves]
#139.6 let's spend momma's money [dirty white boy]
#139.7 psychedelic eyes [electric boys]
#139.8 been caught stealing [jane's addiction]
#139.9 crush [blue tears]
#139.10 last call (for alcohol) [blonz]
#139.11 desperate [kimm rogers]
#139.12 been there, done that [brian eno/john cale]
#139.13 raspberry beret [hindu love gods]
#139.14 the only one i know [the charlatans uk]
#139.15 hammer and a nail+ 3:51 indigo girls (es)
#139.16 superhero [barracuda]
#139.17 broken hearts [two-bit thief]
+ from nomads*indians*saints (epic ek-46820)
#140) tune-up #82
album network cd promo: ???
1992
time: 62:37
-------------------------------------------------------------
#140.1 always the last to know 4:20 [del amitri]
#140.2 bad blood 3:57 [babylon a.d.]
#140.3 2001 4:36 [melissa etheridge]
#140.4 chalk dust torture 4:35 [phish]
#140.5 ragged heart 3:04 [jaime kyle]
#140.6 tv crimes 4:00 [black sabbath]
#140.7 shine 3:49 [medicine man]
#140.8 hang on lucy 4:37 [wildside]
#140.9 galileo+ 4:12 indigo girls (es)
#140.10 divine thing 3:51 [soup dragons]
#140.11 you're so close 4:04 [peter murphy]
#139.12 to hell with love 4:37 [suzanne rhatigan]
#140.13 extraordinary life 4:46 [the believers]
#140.14 like a rembrandt 3:35 [the badlees]
#140.15 has anybody seen the wind 4:34 [ram]
+ from rites of passage (epic ek-48865)
#141) turn of the decade 1989-1990, ben and jerry's newport folk festival
red house records cd: rhcd-36 *
october 1991 cs: rhc-36 *
* schwann pp. 244, 277-8
time: 61:41
-------------------------------------------------------------
#141.1 this land is your land/prelude [pete seeger]
#141.2 american tune 4:09 indigo girls (p. simon)
#141.3 he's got you on his mind [subdudes]
#141.4 delirious [luka bloom]
#141.5 cry like an angel [shawn colvin]
#141.6 teresa la panadera [flaco jimenez]
#141.7 mariano [robert earl keen, jr.]
#141.8 crying for freedom [sweet honey in the rock]
#141.9 she moves through the fair [richard thompson]
#141.10 shallow water [the wild magnolias and
rebirth jazz band]
#141.11 arrow [cheryl wheeler]
#141.12 good morning coffee [greg brown]
#141.13 killing the blues [chris smither]
#141.14 the ballad of penny evans [michelle shocked]
#141.15 to know good will (lee hays' last [pete seeger]
will)/the hills of glenshee
#141.16 this land is your land/reprise [pete seeger and company]
#142) what's for supper?
daemon promo cs: ???
1996
jesus christ superstar sampler, recorded live at south by
southwest, 1996.
time:
-------------------------------------------------------------
#142.? what's the buzz indigo girls
#143) where have all the flowers gone
appleseed cd: 1024
march 17, 1998
pete seeger tribute.
time:
-------------------------------------------------------------
#143.1 where have all the flowers gone [tommy sands, dolores keane,
vedran smailovic]
#143.2 kisses sweeter than wine [jackson browne, bonnie raitt]
#143.3 the water is wide [john gorka]
#143.4 of time and rivers flowing [richie havens]
#143.5 my name is lisa kalvelage [ani difranco]
#143.6 turn, turn, turn [bruce cockburn]
#143.7 festival of flowers [tish hinojosa]
#143.8 step by step [sweet honey in the rock]
#143.9 blessed be the nation [studs terkel]
#143.10 my father's mansions [billy bragg and eliza carthy]
#143.11 sailing down my golden river [greg brown]
#143.12 goofing off suite [tony trischka band]
#143.13 those three are on my mind [kim and reggie harris &
magpie]
#143.14 how can i keep from singing [cordelia's dad]
#143.15 all mixed up [peter, paul & mary]
#143.16 empty pocket blues [ronnie gilbert, robin flower,
libby mclaren]
#143.17 get up and go [tom paxton]
#143.18 old riley [john stewart]
#143.19 if i had a hammer [nanci griffith and friends]
#143.20 wimoweh [the weavers]
-
#143.21 we shall overcome [bruce springsteen]
#143.22 bells of rhymney [roger mcguinn]
#143.23 oh had i a golden thread [judy collins]
#143.24 false from true [guy davis]
#143.25 letter to eve [indigo girls]
#143.26 waist deep in the big muddy [dick gaughan]
#143.27 all my children of the sun [tim robbins]
#143.28 living in the country [martin simpson]
#143.29 one grain of sand [odetta]
#143.30 old father hudson-sailing down dirty [casey neill]
stream
#143.31 the torn flag [john trudell]
#143.32 doublin' [si kahn with the
freighthoppers]
#143.33 to everyone in the world [cathy fink & marcy marxer]
#143.34 over the hills [tommy makem]
#143.35 i come and stand at every door [anne hills]
#143.36 my rainbow race [donovan]
#143.37 quiet early morning [holly near]
#143.38 oh, sacred world [studs terkel]
#143.39 and still i am searching [pete seeger]
#144) women live from mountain stage
blue plate music cd: bpm-???
august 13, 1996
time:
-------------------------------------------------------------
#144.1 lock stock and teardrop [kd lang]
#144.2 strange fire indigo girls
#144.3 the battle of evermore [ann and nancy wilson]
#144.4 sweet sorrow in the wind [emmylou harris]
#144.5 egos like hairdos [ani difranco]
#144.6 amsterdam [joan baez]
#144.7 i kissed a girl [jill sobule]
#144.8 crazy mary [victoria williams]
#144.9 iron horse [kennedy rose]
#144.10 half of a woman [heather eatman]
#144.11 reach for the rhythm [shelby lynne]
#144.12 when i was a boy [dar williams]
#145) the wonder years: music from the emmy award-winning show and its era
atlantic records cd: 82032-2 *
1989 cs: 82032-4 *
* schwann p. 428
time: 44:35
-------------------------------------------------------------
#145.1 with a little help from my 4:14 [joe cocker]
friends
#145.2 baby i need your loving 2:53 [was (not was)]
#145.3 drift away 3:54 [judson spence]
#145.4 for what it's worth (stop, 2:35 [buffalo springfield]
hey, what's that sound)
#145.6 get together+ 3:30 indigo girls
#145.7 in the still of the night 3:54 [debbie gibson]
#145.8 twentieth century fox 3:35 [the escape club]
#145.9 ruby tuesday 3:22 [julian lennon]
#145.10 teach your children 2:51 [csny]
#145.11 brown eyed girl 3:07 [van morrison]
#145.12 will you love me tomorrow 4:08 [carole king]
#145.13 come home (wonder years) 2:03 [debbie gibson]
#145.14 peace train++ 4:30 [richie havens]
+ from strange fire (epic ek-45427)
++ cd only
#146) tedicated
arista cd: 1234 :-) :-)
november 1991 cs: 1234 :-) :-)
note: this album does not exist!
ted nugent tribute album
to benefit people for the ethical treatment of animals
this wonderful *hoax* was perpetrated by pulse magazine about
the time of the great tribute flood of christmastime 1991.
time:
-------------------------------------------------------------
#146.1 cat scratch fever [butthole surfers]
#146.2 wang dang sweet poontang [henry rollins]
#146.3 my love is like a tire iron [r.e.m.]
#146.4 journey to the center of the mind [bongwater]
#146.5 great white buffalo+ [sonic youth]
#146.6 yank me, crank me (but don't wake indigo girls
up and thank me)
+ cd only
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 20:41:51 edt
reply-to: poprckgrrl@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: poprock grrl <poprckgrrl@aol.com>
subject: more ebay yadda yadda yadda
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
seems sleaze ball boy has voluntarily ended his auctions of the ig picture
cds...however, that leaves him 97 auctions still going on...out of curiosity,
i looked at some of the other ones...he had the audacity to use pics in some
of his ads that had people's copyrights big as day on them...
so not only is he sleazy...he's an idiot too...
===========================================
taken out of context i must seem so strange.... ani
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 11:16:30 +1000
reply-to: sherlyn koo <sherlyn@fl.net.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sherlyn koo <sherlyn@fl.net.au>
subject: (fwd) l.a.show tix
x-to: ig-news@smoe.org
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
forwarded from the newsgroup - reply to the original
poster not to me, thanks...
-sherlyn
---begin forwarded message---
>from: marie garnica <marieg@ars-legalservices.com>
>subject: l.a.show tix
>date: mon, 18 oct 1999 07:42:04 -0700
>
>i have two tickets for the ig show in l.a. at the wiltern on friday nov.
>5. the seats are in the loge section, row ff. if anyone is interested
>you can email me at migarnica@netscape.net.
>
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 21:42:38 edt
reply-to: indigokaj@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: indigokaj@aol.com
subject: portland, or
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
hi kind friends,
this is a request, i live in the portland, or area and i have tickets to
the show in eugene, or. i was wondering if anyone has two extra seats and
the willingness to take me and my partner down there. we have been together
for 16 years, so we are a solid couple. we are both 31, and would like to at
least talk on the phone or better yet meet our potential driver. we have to
be able to deal with each other there and back after all.
we need to be back early monday morning ( we have college classes to go
to ), so we really want to head right home after the concert. we could go up
early on sunday.
:-)
kim
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 19:00:47 +0000
reply-to: smackenz@scrippscol.edu
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: froglady <smackenz@scrippscol.edu>
subject: re: indigo girls picture cd
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
whoa, looks like this guy selling the picture cd is pretty pissed about being
told that he's stealing from others for his own profit. i laugh.
-sam (unable to think of any real igc after spending 4 mind numbing hours in
the photo lab)
paulo a wrote:
>
> hey idiot get a life and mind your onw business. i havent stole a thing. cd's come like this. asshole
>
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 21:56:15 -0400
reply-to: neil <neily@netreach.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neil <neily@netreach.net>
subject: discography and indicated (important notes)
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
indicated -
you only have a week or so left
to get your recordings done and in the mail so they arrive by the nov 1
deadline. the time for procrastinaiton is over. if i don't get enough
submissions then it won't be very diverse now, will it?
and:
i'm sure you all read carefully the bit about where to send you comments on
the discography. that would be to me, and not the list:
neily@netreach.net
anyone who quotes exessive amounts of it back to the list, or otherwise
excessively annoys people will be beaten with a very large stick indeed.
(using the same force that will have been used to beat me for bringing it up
in the first place...)
@}--,--'---
abi's page!!! http://www.netreach.net/~andineil/abi/abi.html
this week, neil 'as been been mostly listening to:
richard shindell 'reunion hill'; lou dalgleish 'calmer'; the jam 'live/dig
the new breed'; bo diddley 'the chess box'
song o' the week: 'nessum dorma' - aretha franklin
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 20:08:49 -0700
reply-to: hawke2@email.msn.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: ryan blackhawke <hawke2@email.msn.com>
subject: fw: indigo girls cd response
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
haven't received anything but a canned response from ebay but here's what
the guy said. perhaps we have a lawyer on the list who can shed light on
such issues...
ryan
-----original message-----
from: paulo a [mailto:twain@dbzmail.com]
sent: monday, october 18, 1999 6:13 am
to: ryan blackhawke
subject: re: indigo girls cd
look i havent broken any law the cd is created that way -----original
message----- from: "ryan blackhawke" <hawke2@email.msn.com> date: mon, 18
oct 1999 12:04:56 -0700 to: <twain@dbzmail.com> subject: indigo girls cd >
> > are you aware that alot of these pictures are copyrighted and by
offering > them up like this without permission from the owners you are
breaking > copyright laws? > > > > get your free email from
http://www.dbzmail.com
powered by outblaze
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 20:42:17 -0700
reply-to: dev is me <devisme@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: dev is me <devisme@yahoo.com>
subject: ebay policies..
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hey, y'all!!
my friend neens works for ebay, and i asked her to
make a little announcement to the list...
heeeeeeeeere's neens!!
i heard that there was a discussion about ebay
policies on cd-r, cd-rw and bootlegs. as of 10/17/99,
this is what the policy states:
"ebay policy on music on cd-r:
as a matter of ebay policy, music on cd-r (including
cd-rw) may not be listed on ebay,
unless the seller is the copyright owner and states
this in the item description. this policy also
means that even lawful authorized music recordings on
cd-r are not permitted on ebay. this
following situation illustrates how this might arise.
example: an local band decides to release its latest
album on cd-r. the band sells the album
on cd-r on ebay to katie. this is permissible because
the band is the copyright owner of the
music. katie now wants to resell the music on cd-r on
ebay. the music on cd-r is "lawful
music," but katie (or anyone other than the band) is
not permitted to list this item on ebay.
please note that items not specifically covered by the
policy (for example, "bootleg" recordings of
live performances, "promotional" copies on cd, not
cd-r) may nonetheless be unauthorized and
infringing and could expose sellers to liability or
action by ebay."
you can also check it out for yourself at this url:
http://pages.ebay.com/help/community/png-music.html
if you question anything about any auctions that you
see on ebay, or think someone is doing something that
isn't right, there is a form you can fill out at the
bottom of the url.
hope this clears it up... and thanks for listening!!
(or reading... or whatever..!!)
~neens~
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 20:48:12 -0700
reply-to: hawke2@email.msn.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: ryan blackhawke <hawke2@email.msn.com>
subject: re: ebay strike again
in-reply-to: <01bf19bb$91f51500$47e8dcd8@localhost.maine.edu>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
you can't give negative feedback unless you participate in one of his
auctions. you can post to the community board and write a complaint to
safeharbor@ebay.com.
ryan
> -----original message-----
> why didn't you give him negative feed back? that works far more
> than trying
> to put a "ban on cdr's - as well, i would buy some cdr's of rem, ect, if i
> wanted to.
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: mon, 18 oct 1999 21:11:19 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: lists
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hey everyone,
the welcome email i got when i signed up for this list states:
"please note that nothing will be sent to the news-only list that will
not also be sent to the "regular" list. there is no need to
subscribe to both lists."
however, this does not seem to be the case as people keep sending over
comments from things that were posted to the news-only list.
do i need to sign up for the news-only list as well?
thanks,
jean
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 05:18:06 -0700
reply-to: beccie lyon <dovesland@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: beccie lyon <dovesland@yahoo.com>
subject: ride for chiapas bike trek
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hey guys and gals,
beccie here. nancy and i are looking for someone in the atlanta
area to help us out with the organizing of the bike trek. we
decided that it would be most helpful if someone in atlanta
could help get the word out and help make arrangements for the
ending point of the trek. so, if you are interest please email
either nancy or myself and we will hook you up with where we
stand with things. as of right now we are planning to end the
trek at watershed, but, we are waiting for permission from them
to do so. so, if anyone has an in with the management please
email me about what you can do to help...also, we still need
riders for the trek, if you want to join us for the ride and
help out a great cause in the process come on join up and be a
part of this wonderful idea...we will also have shirts soon
hopefully to sell and maybe a few more surprizes to offer as
well...tee hee...to purchase bonds for the school. any way got
to run...please take a moment to think about what you can do to
help us with this trek. and email me with your ideas and
suggestions...thanks y'all!!!!!
=====
peace, love & indigo light
beccie lyon
may the path that you are on take you above
your expectations for the road ahead
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 08:55:41 -0400
reply-to: kelly fairbairn <fairbk@sage.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kelly fairbairn <fairbk@sage.edu>
subject: not really igc but had to share
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hello everyone..
i hope you're having a wonderful morning. i went to work extra early this
morning, and stepped outside to a brilliantly starry sky and what i think
was venus shining near the horizon. i had a definite "world falls" moment
with n*i*s playing on my brand-spankin' new discperson. sometimes i
grumble about being out of the house before dawn, but it's moments like
that which make it worth every yawn.
thanks to everyone who replied about the view. y'all are cool. :)
kelly
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 05:57:56 -0700
reply-to: "malecki, nancy" <maleckin@fisher-price.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "malecki, nancy" <maleckin@fisher-price.com>
subject: johnny rotten boot
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
uncle, uncle, uncle!!!!
ok, i never post. and i never copy boots, but since there are so many
requests, i thought i'd make the offer.
ok, here goes......(gulp), anyone wanting a copy of the umass show, which
includes johnny rotten, may email me privately @ ransom11@aol.com. i did
boot it and it came out really well. i can't promise my stereo will hold
up, but i'll give it a try. (elise, can you believe i'm doing this????)
nancy
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 09:02:24 -0400
reply-to: "i am 32 flavors and then some..." <tisara@www.webworqs.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "i am 32 flavors and then some..." <tisara@www.webworqs.com>
subject: birthdays (oct. 18 - oct. 24)
mime-version: 1.0
content-type: text/plain; charset=us-ascii
(sorry i didn't send it out last night - airplane delays and changes are a
bitch. *heh*)
october 18 (74)
strange_fire66@hotmail.com (shelley miller)
october 19
dgilliland@mdbe.com (donna gilliland)
october 19
nancy.heuser@mail.mei.com (nancy heuser)
october 21
avital@cs.wisc.edu
(75)
fairbk@sage.edu (kelly)
october 22
wubuh@aol.com (christa)
*********************************n o t e********************************
and a very very very special happy birthday (yep this is me taking all
sorts of liberties again! *heh*) to the following...
mom!!!!!!!!!!!! (oct. 23) thank you for all you gave and continue to
give...i can only hope that i can give back half as much to show you how
much you mean....i love you.
shel (aka f'n bitch *snickers*) (oct. 23) yay! thanks for putting up with
mah shit and picking me up after the horrible ordeal yesterday and all
that other fabulous stuff that is you and that makes our friendship what
it is...now when one of us figures out exactly *what* that is - we'll let
the other know *heh* :)
*************************************************************************
hope it's joyous all!!!!
love and indigo dreams,
audra
bge
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
=<www.geocities.com/westhollywood/2670>=*=<www.angelfire.com/pa/tisara/>=
"you said 'i love you.' why is it that the most unoriginal thing we can
say to one another is still the thing we long to hear?"
--jeanette winterson, "written on the body" (p.9)
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 10:18:11 edt
reply-to: lbuck919@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: luann buck <lbuck919@aol.com>
subject: lyrics to johnny rotten
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
hey everyone...i have a boot of the knoxville, tn show (09/30/99), anyone who
wants a copy email my privately (lbuck919@aol.com). also, i think this is
the first show that amy performed "johnny rotten'...i have posted the lyrics
from the boot below...i think they are pretty close although i may have
misheard a word hear and there.
luann
_________________________
johnny rotten
when i go over yonder
i will see my mother
my father and my sister
oh but my brother is going to hell
well they hung him from the gallows
as the sun turned red from yellow
and the crowd they heard in haunting
and they sighed with much relief
the preacher asked him for any last words
my brother spit onto his clean shirt
and he smiled without redemption
said this is one soul god don't need
well i loved him but i will miss him
as he's burning and he's twisting
for his heartless dedication
to the devil and his creed
for as a child we called him rotten
til he was lonely and forgotten
and he revenged our constant jeering
with his every word and deed
oh yeah he fought my contribution
and the souls lack of retribution
i will ask the lords forgiveness
on my very bended knees
oh it's the tale of johnny rotten
who was lonely and forgotten
and it's the tale of my only brother
and it's the tale of one bad seed.
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 11:05:08 -0400
reply-to: erica weinstein <eweins1@po-box.mcgill.ca>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: erica weinstein <eweins1@po-box.mcgill.ca>
organization: a woman without a man is like a fish without a bicycle
subject: nigc: lesbian movies
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
i am organizing an event at my school called "dyke days." part of the
week long event will be a movie night. i was planning to show "the
incredibly true adventures of two girls in love" and "french twist."
does anyone know of any other good lesbian films i could rent? thanks a
lot.
erica
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 11:14:08 edt
reply-to: mariedemi@cs.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: marie demiguel <mariedemi@cs.com>
subject: one ticket available for athens, ga 10/22
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
anybody interested email me.
thanks,
marie
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 09:21:44 -0600
reply-to: chris <chris@ultralink.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: chris <chris@ultralink.com>
subject: re: nigc: lesbian movies
x-to: erica weinstein <eweins1@po-box.mcgill.ca>
in-reply-to: <380c88a4.c46e42f2@po-box.mcgill.ca>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
i would get "fire" it was a great movie out of india. it was banned
there...it is about to sisters in law who fall in love.
at 11:05 am 10/19/99 -0400, erica weinstein wrote:
>i am organizing an event at my school called "dyke days." part of the
>week long event will be a movie night. i was planning to show "the
>incredibly true adventures of two girls in love" and "french twist."
>does anyone know of any other good lesbian films i could rent? thanks a
>lot.
>
>erica
>
>--
>please do not send excessive amounts of quoted text and/or nigc,
> long signatures, attachments or flames to the list.
>indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
>
chris iggulden, ma
"in the interdependent world in which we now live, rich and poor; strong
and weak are bound in a common destiny that decrees that none shall enjoy
lasting prosperity and stability unless others do too."
president nelson mandela of south africa
canadian parliament, september 24, 1998
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 15:31:45 +0000
reply-to: kz123@att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristen curry <kz123@att.net>
subject: re: nigc: lesbian movies
there are some truly great ones out there...
"go fish" - a small independent movie. i loved it. it's
in black and white. some people do not like it's
"homemade" look, but i loved the story, too.
"when night is falling" - very beautiful to look at. a
nice funky subplot.
"entre nous" - this is an french movie from around the
'60's i believe. very well done.
"desert hearts" - the lesbian movie. great story, acting
and nice polished "hollywood" look to the movie.
those are my suggestions, anyway.
cheers,
kc
> i am organizing an event at my school called "dyke days." part of the
> week long event will be a movie night. i was planning to show "the
> incredibly true adventures of two girls in love" and "french twist."
> does anyone know of any other good lesbian films i could rent? thanks a
> lot.
>
> erica
>
> --
> please do not send excessive amounts of quoted text and/or nigc,
> long signatures, attachments or flames to the list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 08:44:21 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: re: nigc: lesbian movies
mime-version: 1.0
content-type: text/plain; charset=us-ascii
this is actually a great general question... i am always looking for a
good lesbian film/movie/flick i haven't seen yet. what are people's
favorites?
"watershed" and "live at the uptowm lounge" don't count! ;-)
~jean
--- erica weinstein <eweins1@po-box.mcgill.ca> wrote:
> i am organizing an event at my school called "dyke days." part of
> the
> week long event will be a movie night. i was planning to show "the
> incredibly true adventures of two girls in love" and "french twist."
> does anyone know of any other good lesbian films i could rent?
> thanks a
> lot.
>
> erica
>
> --
> please do not send excessive amounts of quoted text and/or nigc,
> long signatures, attachments or flames to the list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 11:51:22 -0400
reply-to: havanamoon <missing_lynx@email.msn.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: havanamoon <missing_lynx@email.msn.com>
subject: re: nigc: lesbian movies
x-to: erica weinstein <eweins1@po-box.mcgill.ca>
all over me, everything relative, antonia's line, live nude girls all have
significant lesbian content.
enjoy!
tim
-----original message-----
from: erica weinstein <eweins1@po-box.mcgill.ca>
to: indigo-girls@netspace.org <indigo-girls@netspace.org>
date: tuesday, october 19, 1999 11:11 am
subject: nigc: lesbian movies
>i am organizing an event at my school called "dyke days." part of the
>week long event will be a movie night. i was planning to show "the
>incredibly true adventures of two girls in love" and "french twist."
>does anyone know of any other good lesbian films i could rent? thanks a
>lot.
>
>erica
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 11:11:56 -0600
reply-to: "sarah t. rosenblum" <strosenblum@students.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "sarah t. rosenblum" <strosenblum@students.wisc.edu>
subject: nigc lesbian movies
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
>this is actually a great general question... i am always looking for a
good lesbian film/movie/flick i haven't seen yet. what are people's
favorites?
~jean
high art high art high art!!!!!!
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 12:12:51 edt
reply-to: chance0631@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: chance0631@aol.com
subject: re: nigc lesbian movies
x-to: strosenblum@students.wisc.edu
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i've heard of other lesbian/lesbian content movies but have yet to see them.
they include inn trouble and better than chocolate, and when night is falling.
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 17:32:08 +0100
reply-to: marion_o'sullivan@health.irlgov.ie
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: marion_o'sullivan@health.irlgov.ie
mime-version: 1.0
content-type: text/plain; charset=us-ascii
indigo girls band together from launch.com
http://www.launch.com/features/fs_start/?contentid=4249&contenttype=news&vo
=mnwn
(10/19/99, 7 a.m. pdt) - for the song "gone again" on
their recently
released album, come on now social, the indigo girls
got help from a
couple of the group's songwriting idols. the band's
rick danko and garth
hudson (bass and keyboards, respectively) lent their
talents to the recording.
with sheryl crow and drummer jerry marotta also
appearing on the track,
"gone again" is truly an all-star effort.
one half of the indigo girls, amy ray, tells launch
about how they got
danko and hudson to bring a band feel to the track. "we
recorded that at
jerry marotta's studio.one of our old drummers. jerry
is such a great drummer
and he's very sort-of in the levon [helm, of the band]
school of drumming.
so he's perfect for that."
"garth and rick came down and we just did it live, and
then i recorded the
vocals again somewhere else, but their vibe
is...there's no way to describe it,"
ray adds. "it's unbelievable. i love, love, love
playing with them. and i love
garth. his storytelling is just incredible and
intellectual and heart-wrenching."
hudson makes a second appearance on the new indigo
girls song, "ozilline."
the indigo girls have a few days off before resuming a
tour on oct. 22 at the
university of georgia in the band's hometown of athens.
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 12:34:07 edt
reply-to: erinsuepoo@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "<erin carroll>" <erinsuepoo@aol.com>
subject: nigc holiday card exchange
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i know it is early to be thinking of the holidays...but has anyone considered
doing the card exchange again? i can't remember who organized it last
year...but i would be happy to get involved this year. something to think
about... and if you are out there...the brave soul that undertook the
project last year, please let me know if you are interested in doing that
again...or if you would like someone else to take charge this year. it is
always so much fun!
take care....
the age poll is coming along very nicely!
erin sue
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 12:26:11 -0400
reply-to: nancy lambert <nlambert@inter-science.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: nancy lambert <nlambert@inter-science.com>
subject: re: nigc lesbian movies
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
"it's in the water" was a good one at the film festival 2 or 3 years ago. i
do not recommend "inn trouble" about the only thing good in it was cooper.
the acting sucked -- i've seen better from 6 year olds. just my opinion
nan
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 09:46:22 -0700
reply-to: amy swenson <aswenson@cthulhu.engr.sgi.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: amy swenson <aswenson@cthulhu.engr.sgi.com>
subject: best way to buy out of state tickets for chicago???
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
hi everyone -
after determining that i am totally insane, i've decided to fly "home"
to chicago for the concert in december. not totally trusting that my
parents are crazy (or knowledgable) enough to wait in the right
ticketmaster location before tickets go on sale, i'm considering the
online thing.
my questions are:
does ticketmaster release tickets for online sales at the same time as
they release them for outlet sales?
is ticketmaster handling the chicago concert?
has anyone had luck getting good seats on ticketmaster for out of state
shows the day/time of the sale?
is the chicago concert a "regular" concert, or is it just a christmas
show? someone posted info that it's for a children's charity, which is
so cool, but as much as i love the girls, i don't know if i'd fly all
that way to hear them sing christmas songs...
i pretty much have to decide on the plane tickets today so any info on
the above would be greatly appreciated!!!!!!!
love,
amy
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 17:09:22 +0000
reply-to: kz123@worldnet.att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kz123@worldnet.att.net
subject: re: nigc: lesbian movies
all over me is great great great. coming of age
story. oh, and kd lang's girlfriend plays the cute
punk guitar girl with the raggedy ann hair.
loved antonia's line, too.
kc
> all over me, everything relative, antonia's line, live nude girls all have
> significant lesbian content.
>
> enjoy!
> tim
>
> -----original message-----
> from: erica weinstein <eweins1@po-box.mcgill.ca>
> to: indigo-girls@netspace.org <indigo-girls@netspace.org>
> date: tuesday, october 19, 1999 11:11 am
> subject: nigc: lesbian movies
>
>
> >i am organizing an event at my school called "dyke days." part of the
> >week long event will be a movie night. i was planning to show "the
> >incredibly true adventures of two girls in love" and "french twist."
> >does anyone know of any other good lesbian films i could rent? thanks a
> >lot.
> >
> >erica
>
> --
> please do not send excessive amounts of quoted text and/or nigc,
> long signatures, attachments or flames to the list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 10:09:03 pdt
reply-to: dana maxim <lurker98@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: dana maxim <lurker98@hotmail.com>
subject: re: lyrics to johnny rotten
mime-version: 1.0
content-type: text/plain; format=flowed
actually, she performed it first (at least, publically) in atlanta this
spring at the variety playhouse to a crowd of 200-300 people at an earth day
concert.
:-)
----original message follows----
from: luann buck <lbuck919@aol.com>
reply-to: lbuck919@aol.com
to: indigo-girls@netspace.org
subject: lyrics to johnny rotten
date: tue, 19 oct 1999 10:18:11 edt
hey everyone...i have a boot of the knoxville, tn show (09/30/99), anyone
who
wants a copy email my privately (lbuck919@aol.com). also, i think this is
the first show that amy performed "johnny rotten'...i have posted the lyrics
from the boot below...i think they are pretty close although i may have
misheard a word hear and there.
luann
_________________________
johnny rotten
when i go over yonder
i will see my mother
my father and my sister
oh but my brother is going to hell
well they hung him from the gallows
as the sun turned red from yellow
and the crowd they heard in haunting
and they sighed with much relief
the preacher asked him for any last words
my brother spit onto his clean shirt
and he smiled without redemption
said this is one soul god don't need
well i loved him but i will miss him
as he's burning and he's twisting
for his heartless dedication
to the devil and his creed
for as a child we called him rotten
til he was lonely and forgotten
and he revenged our constant jeering
with his every word and deed
oh yeah he fought my contribution
and the souls lack of retribution
i will ask the lords forgiveness
on my very bended knees
oh it's the tale of johnny rotten
who was lonely and forgotten
and it's the tale of my only brother
and it's the tale of one bad seed.
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 13:16:03 edt
reply-to: poprckgrrl@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: poprock grrl <poprckgrrl@aol.com>
subject: dyke films
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
haven't seen any mention of watermelon woman...
i thought it was pretty good...
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 13:10:22 -0400
reply-to: nancy lambert <nlambert@inter-science.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: nancy lambert <nlambert@inter-science.com>
subject: re: dyke films
x-to: "poprckgrrl@aol.com" <poprckgrrl@aol.com>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
that was a good one. so was better than chocolate. god i love dyke
films!!!! i'm getting veklempt now oy!
-----original message-----
from: poprock grrl [mailto:poprckgrrl@aol.com]
sent: tuesday, october 19, 1999 12:16 pm
to: indigo-girls@netspace.org
subject: dyke films
haven't seen any mention of watermelon woman...
i thought it was pretty good...
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 13:24:18 edt
reply-to: lisalisaa@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lisalisaa@aol.com
subject: interviewing ig--looking for questions
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
hey all. i am in the process of setting up interviews with the girls to do a
story for sonicnet. while the logistics creep along, how about you guys
suggest some questions you'd like answered. cant think of a better group to
ask for help.
please email the questions here by fri (if that changes, i'll let you know.)
thanks.
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 10:50:29 -0700
reply-to: hawke2@email.msn.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: ryan blackhawke <hawke2@email.msn.com>
subject: fw: illegal auctions (kmm5400452c0km)
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
sure enuff, ebay doesn't do anything.
-----original message-----
from: safe harbor [mailto:safeharbor@ebay.com]
sent: tuesday, october 19, 1999 10:32 am
to: ryan blackhawke
subject: re: illegal auctions (kmm5400452c0km)
hello ryan,
we have reviewed the auctions you have brought to our attention and
taken appropriate action. we would also like to explain ebay's policy
with respect to reports like yours. ebay is not in a position to make
judgments about the authenticity or authorized nature of auction items,
except in the most extreme circumstances. this may mean that we cannot
remove the item about which you contacted us. in some cases, we refer
the information to the owner of the rights (copyright, trademark, etc.)
involved, if we know who they are and how to contact them.
we often cannot remove items upon the representations of third parties
whose credentials we cannot verify, unless of course the alleged
infringement is obvious on its face. that is why we strongly urge you
to notify the rights holder of the suspected infringement and encourage
them to join our verified rights owners (vero) program (formerly called
legal buddy program). this program enables them to request the ending
of allegedly infringing auctions.
we appreciate your vigilance in helping us to keep inappropriate
auctions off ebay.
as always, if you have a question or problem, please contact us and we
will gladly assist you. if you would like to report a questionable item
please visit:
http://pages.ebay.com/services/safeharbor/report-infringing.html
thanks for using ebay!
regards,
sunny
ebay customer support
______________________________
ebay
your personal trading community (tm)
****************************
for our latest announcements, please check
http://www2.ebay.com/aw/announce.shtml
****************************
original message follows:
-------------------------
my user id is 2hawke
i noticed another user who had an illegal auction set up for a cd-r of
copyrighted material stolen from the web of indigo girls picture. it
seems
after he received several complaints he ended that auction. however, he
has
another 97 auctions of similar material currently going on. i am sure
ebay
wants to maintain its hard-won reputation for closing down illegal
auctions.
his email address is twain@dbzmail.com.
ryan blackhawke
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 11:54:17 -0600
reply-to: garian <vigil@ucsu.colorado.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: garian <vigil@ucsu.colorado.edu>
subject: re: ebay and good films
in-reply-to: <ncbbjhddaliahamkpiohoeghcjaa.hawke2@email.msn.com>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
> except in the most extreme circumstances. this may mean that we cannot
> remove the item about which you contacted us. in some cases, we refer
> the information to the owner of the rights (copyright, trademark, etc.)
> involved, if we know who they are and how to contact them.
this reinforces that you should all put your email addresses in your photo
copyright notice.
also, i loved _relax, it's just sex_. i don't know if it's out on video
yet, but see it if you have the opportunity (tankgirl is in it)!!
g.
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 14:44:28 edt
reply-to: emliz92@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristin roberts <emliz92@aol.com>
subject: igc:a pic question
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
hey gang,
i have a number of different pics from the concerts i have been going to
over the past couple of years. most of them have indigo girls on the front
with either a song title on the back or the album name. all the pics i have
are from 1996 and on with the oldest just having indigo girls on the front.
my question is what do earlier pics look like? do they still have their name
on them? are they yellow? just curious. thanks for the info.
~kristin
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 18:53:08 gmt
reply-to: that loud girl <strange_fire66@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: that loud girl <strange_fire66@hotmail.com>
subject: re: nigc holiday card exchange
mime-version: 1.0
content-type: text/plain; format=flowed
erin & ig listees everywhere:
yup, i guess its about time to start thinking of the card exchange again,
and, as much as i enjoyed running it and getting all sorts of goodies from
y'all last year, i'd love it if someone else could take over (i'm still
trying to get out all the branch copies for the smallternative tape)...so
erin, if you want to do it, e-mail me off the list, and everyone else,
here's a shameless plug for this thing--the card exchange is a great way to
get a whole mailbox full of impossibly giddy ig holiday cheer--some people
come up with quite the creative home-made cards.
ho,ho,ho on this beautifully sunny midwestern day,
shel
>from: "<erin carroll>" <erinsuepoo@aol.com>
>reply-to: erinsuepoo@aol.com
>to: indigo-girls@netspace.org
>subject: nigc holiday card exchange
>date: tue, 19 oct 1999 12:34:07 edt
>
>i know it is early to be thinking of the holidays...but has anyone
>considered
>doing the card exchange again? i can't remember who organized it last
>year...but i would be happy to get involved this year. something to think
>about... and if you are out there...the brave soul that undertook the
>project last year, please let me know if you are interested in doing that
>again...or if you would like someone else to take charge this year. it is
>always so much fun!
>
>take care....
>the age poll is coming along very nicely!
>erin sue
>
>--
>please do not send excessive amounts of quoted text and/or nigc,
> long signatures, attachments or flames to the list.
>indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 11:56:54 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: tabernacle show
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hey everyone,
as it happens, i had planned to visit a friend of mine in atlanta the
weekend of the 17th. i was looking over the tour schedule today and
discovered that there is a show at the tabernacle on the 17th!! how
thrilled was i?
anyway, i know nothing about getting tickets in atlanta and was
wondering if anyone knows anything about the venue and when tickets go
on sale. is anyone planning on going to this show? i would like to
take my friend and her partner along as well, so i was thinking of
getting three tickets. if anyone happens to be standing in line for
tickets i will make it worth your while to pick me up 3 or 4. i can
send $$ in advance.
if you have any info at all, please email me at sneakyjean@yahoo.com
thanks!
jean
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 19:58:25 +0100
reply-to: john bond <john.bond@lineone.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: john bond <john.bond@lineone.net>
subject: re: nigc lesbian movies
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
hey y'all,
> >this is actually a great general question... i am always looking for a
> good lesbian film/movie/flick i haven't seen yet. what are people's
> favorites?
> ~jean
oooooh ----- go fish (just the best i've ever seen - anybody have any good
ideas of a gay man equivalent?), high art and better than chocolate (i'm
just a sucker for romance :) ). i think this thread might have legs.....
john.
--
"every sperm is sacred,
every sperm is great.
if a sperm is wasted,
god gets quite irate..."
(monty python - the meaning of life)
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 12:29:43 -0700
reply-to: "amy j. putnam" <pegasus@crl.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "amy j. putnam" <pegasus@crl.com>
subject: re: ebay and good films
x-to: garian <vigil@ucsu.colorado.edu>
in-reply-to: <pine.gso.3.96.991019115204.24801e-100000@ucsu.colorado.edu>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
on tue, 19 oct 1999, garian wrote:
>
> this reinforces that you should all put your email addresses in your photo
> copyright notice.
which only works if the thief hasnt cropped it out of the photo.
i'm still looking for a web site which has some of my early (1990)
ig shows. the owner of the site gave permission for the photos
to beused in a screen saver. i've never scanned the photos myself
so the web site owner has to be someone i met, once upon a time.
when i discovered the photos in the screen saver, those folks
were very accomodating in removing them, but could locate the
address of the site so i could contact the web page owner.
so, if anyone happens to know of a site where there are two
photos of amy and emily at newport, long ago...amy has jeans with a
rip in the knee and a husker du shirt. emily is wearing
a green shirt with a gold chain. there are two shots..amy is at the mike
in one, and emily at the mike in the other. i would very much
like to find this site (and yes, i have checked the web rings and
indices and done extensive searches through lycos and a couple of
other engines.
also makes me wonder if any of my photos are on the cd on e-bay/
thanks for any help.
_________
amy p. \ / who holds your hand
pegasus@crl.com \ / when you're alone
monk@world.std.com \ /
the original photo monk \ / --patty larkin
http://www.crl.com/~pegasus
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 15:57:30 edt
reply-to: lisalisaa@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lisalisaa@aol.com
subject: ig interview
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
you guys are truly cool fans...i wonder if they know...so far the number
question seems to be what the hell emily is saying on sister. i will ask.
the rest of the questions have been good but general. so let me be a little
more specific. my idea is to really concentrate on the new album and the
shift in musical directions. i will also focus on what they are going to be
doing in 2000.
if you think of anything you want to know on those topics, please send me the
questions. keep em coming. thanks
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 15:23:20 -0600
reply-to: "sabrina d. parker" <parkers@civerolo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "sabrina d. parker" <parkers@civerolo.com>
subject: lucky find
mime-version: 1.0
content-type: text/plain
i am a lucky girl today!
i now have a brand new black and white publicity photo of the indigo girls -
taken by michael halsband and dated 1999. it was distributed by epic
(numbered 9908). they look like they are sitting on a "roadside stand".
i can't think of any other way to describe it. just a square structure with
a roof over it. i think it might be one of the photos they have on the ig
web site, but i can't remember. a great photo!
some days it's the little things that make you happy.
happy day all.
sabrina
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 21:47:33 gmt
reply-to: that loud girl <strange_fire66@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: that loud girl <strange_fire66@hotmail.com>
subject: nigc-eating disorders quilt project
mime-version: 1.0
content-type: text/plain; format=flowed
i saw this on the something fishy eating disorders website (www.sfwed.com),
and thought that some of you might be interested--for the contact person's
name/e-mail, check the above mentioned site under "special bulletins":
project ostrich
goal: to encourage sufferers, healthcare providers, and others not to
"bury their hands in the sand" but rather to recognize the devastating
consquences of eating disorders.
to launch this effort, i would like to put together a quilt of jean
pockets that those affected by eating disorders are literally dying to
get into (in other words, pants that are too small). i have asked that
people that are interested send a pocket with their first name, age,
and city/state. people can decorate their pockets if they want to.
pockets should be send to:
project ostrich
1048 sw ashworth place
topeka, ks 66604
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 15:09:01 -0700
reply-to: arjuna greist <endarphine@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: arjuna greist <endarphine@yahoo.com>
subject: re: dyke films
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hey y'all,
about watermelon woman- my film professor cheryl
wrote, directed, & starred in it, & my other film
professor (her partner) alex produced it. it's *such*
a good film, & i'm so excited to do an independent
study with cheryl next year in queer documentary.
though i might take it with alex... whichever, they're
both wonderful people & great teachers- and they both
have the cutest little tykes that anyone could
babysit!
i've also seen some of cheryl's earlier films from
grad school, & they're all impressive, with that
quirky cheryl twist. too bad there's only a coupla
copies in existence.
i love go fish, antonia's line (which is about love in
general, although the artichoke scene is one of my
faves), all over me (the pink-haired cutie isn't just
kd lang's girlfriend, she's 1/2 of the murmers), 2
girls in love, high art, and how is everyone
forgetting bound?! ooooh, i love that film. though it
was at all of the same festivals as watermelon woman &
kind of overshadowed it, so i have some vicarious
resentment from cheryl & alex. :p
i dunno about ones that live up to these about gay
men, but jeffrey is excellent, & billy's hollywood
screen kiss ain't too bad. strawberries & chocolate, a
film from cuba, is really sweet (pun intended) if you
can find it. & of course, tongues untied is amazing,
but i've only watched it 3 times as a film major here
:p
peace,
arjuna
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
"what the &%*$ did she do to you, vi?!" -ceaser
"everything you couldn't." -violet
-bound
~~~~~~~~~~~~~~
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 17:59:27 edt
reply-to: shedyskin@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: shedyskin@aol.com
subject: ig tickets
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
hi y'all. since i won't be able to purchase the ig tickets for the chicago
show on the first day of sale, i'm pretty sure they'll be all gone by the
time i get back, so i might have to get tickets from, yikes, scrapers?? can
anyone let me know any other way to get tickets? newspaper? e-bay?
any help will be very much appreciated, this will be my first ig only show
(i've been to llith...etc)and i can't possibly miss this show (or to be in a
very bad seat!!) . too bad i can't ask my friend to change her wedding date.
peace
dorothy
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 18:01:15 -0400
reply-to: neil <neily@netreach.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neil <neily@netreach.net>
subject: ebay and where to buy import cds...
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
two thoughs on ebay and then where to get proper 'rare imports'
1) if they ban cd-rs, then people are just going to stop saying they're
cd-rs and so the problems melissa had with not realizing it was a cd-r she
was getting are just going to increace...
2) ebay will only stop an auction if you can prove it's unauthorized, if you
can't, why should they stop an auction on your sayso there are lotsa loonys
out there... you either have to give 'em the facts, or contact the copyright
owner. which is why record companies have the riaa - so that there's some
group to look out for their interests. same with bmi and ascap for
performers...
anyway, i have a source for at least one indigo girls bootleg (in with the
out crowd - a fine, fine disc) for only $22 inc. postage, which is better
than a kick in the teeth if you ask me...
the url (and they post it too newsgroup(s) themselves, so i'm sure they
won't mind me repeating it here...)
http://www.cyberway.com.sg/~livecds/
very reliable. can't reccomend them enough...
neil
@}--,--'---
abi's page!!! http://www.netreach.net/~andineil/abi/abi.html
this week, neil 'as been been mostly listening to:
richard shindell 'reunion hill'; lou dalgleish 'calmer'; the jam 'live/dig
the new breed'; bo diddley 'the chess box'
song o' the week: 'nessum dorma' - aretha franklin
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 18:16:53 edt
reply-to: wishmonstr@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "e. moranian bolles" <wishmonstr@aol.com>
subject: re: another johnny rotten question
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
it's possible someone already answered this, but i'll go ahead anyway.
the song amy has been singing is not the neil young song in question.
~ elizabeth
in a message dated 10/18/99 3:34:56 pm eastern daylight time, bean@neu.edu
writes:
<< is the song that's being called "johnny rotten" actually the one that
neil young did several years back called "out of the blue and into the
black" or "rust never sleeps" or something like that? that song keeps
coming to mind - in it he makes reference to johnny rotten "the king is
gone but he's not forgotten. this is the story of johnny rotten". mr.
young absolutely rocks. so does anyone know if this is the same song
that amy did? or is there actually a song called johnny rotten? >>
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 18:56:49 -0400
reply-to: elaine bean <efbean@erols.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: elaine bean <efbean@erols.com>
subject: nigc - dyke films
x-to: arjuna greist <endarphine@yahoo.com>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
arjuna greist wrote:
> forgetting bound?!
those lips, those eyes, that tat - was it a real one? or fake, just for
the movie? . . . gina gershon . . . <sweat>
what an actress! if i didn't know she was straight, i'd swear she
wasn't. wasn't it the best movie? it was so rewarding seeing them
getting theirs. i thought it was a lesbian thelma & louise. not that
the movies were at all similar - only similar in the sense that it
showed women in empowerment mode - there's a whole feminist thesis just
bursting to come out, but at the risk of boring many on the list, i
won't. i hear sighs of relief.
elaine
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 22:41:39 +0000
reply-to: kz123@att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristen curry <kz123@att.net>
subject: re: nigc lesbian movies
i loved high art, but i get sick of certain kinds of
endings. those of you who've seen it know what i mean.
those of you who haven't, go rent it, love it, come back
and we can discuss the ending.
for boy romance try out "beautiful thing". it's a coming
of age story and a very sweet movie.
always nice to hear somebody else loved "go fish" as much
as i did :-) i just saw "better than chocolate" and i
loved it, too. but i'm kind of a sap sometimes.
cheers,
kristen
> oooooh ----- go fish (just the best i've ever seen - anybody have any good
> ideas of a gay man equivalent?), high art and better than chocolate (i'm
> just a sucker for romance :) ). i think this thread might have legs.....
>
> john.
>
> --
> "every sperm is sacred,
> every sperm is great.
> if a sperm is wasted,
> god gets quite irate..."
>
> (monty python - the meaning of life)
>
> --
> please do not send excessive amounts of quoted text and/or nigc,
> long signatures, attachments or flames to the list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 19:21:47 edt
reply-to: mgsb@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: mgsb@aol.com
subject: wfuv interview
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
did anyone tape this interview??? i would really like to get a copy of it
if anyone did tape it!!! email me if you did and hopefully we could work out
a trade.
thanks
sandy
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 19:31:34 edt
reply-to: tenaindigo@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: tina crawford <tenaindigo@aol.com>
subject: re: nigc - dyke films
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i sit here reading through all your mail and im screaming "hey theres bound,
what about bound. i can not believe nobody has said bound!!!" :) and then i
finally get towards the end and was relieved when i see that yes bound did
get mention. whew!! gina was too good in that film. has anyone seen her in
that new fox sitcom snoops? she is a private investigator. also high art was
good too. saw claire of the moon and bar girls but i wasn't impressed.
speaking of films however, i would love to see them put some of patricia
cornwells books on film. hell i have been in love with dr scarpettas niece
lucy for the longest time! okay so maybe its just lust, but ya know, it's
just not right when your dream girl is fictional!
take care all
tena
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 19:38:22 edt
reply-to: tenaindigo@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: tina crawford <tenaindigo@aol.com>
subject: nigc- lesbian films
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
ooh almost 4got another movie i thought was good, gia. just loved angalina
jolie.(sp?) it had lesbian content. it also had a sad ending but since it was
based on a true story i guess that's life for ya. my gf who is a recovered
addict had a hard time watching it though cuz of all the drugs it showed her
doing. made her nervous.
take care
tena
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 16:39:55 -0700
reply-to: larissa brown <larissa.brown@eng.sun.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: larissa brown <larissa.brown@eng.sun.com>
subject: sf-warfield show?
mime-version: 1.0
content-type: text/plain; charset=us-ascii
could someone email me privately and tell me, have i missed the date to buy tix
for the warfield show?
i am so lost!
thanks much lovies,
larissa
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 19:39:16 -0400
reply-to: "diane g." <dispdmg@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "diane g." <dispdmg@yahoo.com>
subject: more movies....
mime-version: 1.0
content-type: multipart/alternative;
boundary="----=_nextpart_000_0126_01bf1a69.a11d3f40"
this is a multi-part message in mime format.
------=_nextpart_000_0126_01bf1a69.a11d3f40
content-type: text/plain;
charset="windows-1252"
content-transfer-encoding: quoted-printable
i didn't see it anywhere else -=20
personal best=20
------=_nextpart_000_0126_01bf1a69.a11d3f40
content-type: text/html;
charset="windows-1252"
content-transfer-encoding: quoted-printable
<!doctype html public "-//w3c//dtd html 4.0 transitional//en">
<html><head>
<meta content=3d"text/html; charset=3dwindows-1252" =
http-equiv=3dcontent-type>
<meta content=3d"mshtml 5.00.2314.1000" name=3dgenerator>
<style></style>
</head>
<body bgcolor=3d#ffffff>
<div><font face=3darial size=3d2>
<div><font face=3darial size=3d2>i didn't see it anywhere else - =
</font></div>
<div> </div>
<div><font face=3darial size=3d2>personal best </font></div>
<div> </div>
<div> </div></font></div></body></html>
------=_nextpart_000_0126_01bf1a69.a11d3f40--
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 09:40:33 +1000
reply-to: sherlyn koo <sherlyn@fl.net.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sherlyn koo <sherlyn@fl.net.au>
subject: (fwd) colorado ticket for sale
x-to: ig-news@smoe.org
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
forwarded from the newsgroup - please direct your replies to the
original poster at coaeig@aol.com, not to me... thanks...
-sherlyn
---begin forwarded message---
>from: coaeig@aol.com (coaeig)
>subject: colorado ticket for sale
>date: 19 oct 1999 21:53:19 gmt
>
>i have one ticket to the fillmore show in denver on nov.19th at 8pm for
general
>admission (the whole show is ga) i will sell at face value 38.30. email if
>interested.
>
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 09:50:19 +1000
reply-to: sherlyn koo <sherlyn@fl.net.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sherlyn koo <sherlyn@fl.net.au>
subject: fw: brief " review " of come on now social
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
forwarded from the newsgroup...
-sherlyn
---begin forwarded message---
>date: tue, 19 oct 1999 05:14:28 -0700 (pdt)
>from: "joe p. shenk" <joeshenk@yahoo.com>
>subject: [ig-news] brief " review " of come on now social
>
> hi , all .
>
> thought you'd appreciate this glowing description of the indigo girls'
>new album from " latest
>releases at cdnow " ( cdnow e-mail service ) :
>
> --joe
>
>indigo girls
>come on now social
>
>the latest album from the indigo girls is one of their most diverse and
>compelling works to date.
><i>come on now social,</i> the album that began as a london jam session,
>has grown into a manifold
>masterpiece, featuring the talents of joan osborne, sheryl crow and
>me'shell ndegeocello.
>
>=====
>joeshenk@yahoo.com
>
>my home page (currently on kosovo ,etc.) :
>
>http://www.geocities.com/capitolhill/congress/8420
>__________________________________________________
>do you yahoo!?
>bid and sell for free at http://auctions.yahoo.com
>
--
please do not send excessive amounts of quoted text and/or nigc,
long signatures, attachments or flames to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 20:25:46 -0400
reply-to: alisa greenberg <agreenb1@swarthmore.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: alisa greenberg <agreenb1@swarthmore.edu>
subject: films
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
not exactly a stricly gay based film, but threesome was really very good.
a short, little film about three kids, a woman and two men, and the love
triangle that ensues.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 20:26:27 -0400
reply-to: anna creech <creechal@jmu.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: anna creech <creechal@jmu.edu>
organization: james madison university
subject: re: ebay and where to buy import cds...
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
neil pointed out one really good place to get boot cds, but there are several
out there. in fact, in with the out crowd was done by one of the best of them,
kiss the stone. their website is http://www.kissthestone.com/ (which is
frequently mentioned in various newsgroups).
with regard to ebay and cd-r boots, i have been burned once there and am much
more careful now. has anyone actually found a copy of toad's place that isn't
cd-r? the one i had (briefly) was advertised as an original, but what i got was
a pathetic excuse for a cd-r copy. they didn't even go to the trouble of doing
a nice job with the liner and label. there was another time when i noticed a
guy selling another one of the rare boot cds. i emailed him and asked if it was
an original or a copy. he said it didn't matter 'cause the quality was the same
since it was all digital and that he had a number of copies of it. that was
only after asking him more specific questions over several rounds of email.
later i noticed he was doing a dutch auction - probably trying to get rid of his
stash quickly. ebay didn't do a thing about it, even when i sent them copies of
the emails he had sent me.
so, my advice is, ask before you bid if you must get them from ebay. at this
point, though, i doubt there's anything real there - just a bunch of
"entrepreneurs" with cd burners.
anna
--
http://raven.jmu.edu/~creechal/index.htm ~ np: spring
see no evil, hear no evil, date no evil.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 10:59:18 +1000
reply-to: sherlyn koo <sherlyn@fl.net.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sherlyn koo <sherlyn@fl.net.au>
subject: fw: wnba cd release-ig & others
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
forwarded from the news-only list...
-sherlyn
---begin forwarded message---
>date: tue, 19 oct 1999 20:37:38 edt
>subject: [ig-news] wnba cd release-ig & others
>from: pwboston@aol.com
>
>first-ever wnba compact disc to be released at nba store on fifth avenue;
>divas of the court' will debut at destiny's child concert; sales to benefit
>fight against breast cancer
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
>
>new york, oct. 19 /prnewswire/ -- "divas of the court: songs from the wnba,
>volume i," a new 14-song compact disc from nba entertainment and sfx
alphabet
>city sports records, will be released saturday, october 23, at the nba store
>on fifth avenue, following a live performance by columbia recording artist
>destiny's child.
>
>proceeds from sales of the compilation cd will benefit the national alliance
>of breast cancer organizations (nabco). in addition, the wnba and sfx
>alphabet city sports records will present a $25,000 check to nabco at the
>concert, which will be hosted by rebecca lobo of the new york liberty and
>begin at 1:00 p.m./et.
>
>"this compact disc is a musical celebration of the wnba," said wnba
president
>val ackerman. "we're pleased to bring together so many great songs from our
>first three seasons and proud to continue to help the fight against breast
>cancer."
>
>"divas of the court" features historic audio highlights of the first three
>wnba seasons and hit songs from 14 recording artists: destiny's child
>("jumpin, jumpin"); monica ("don't take it personal?"; vanessa williams
>("happiness"); luscious jackson ("friends"); shawn colvin ("round of
blues");
>imani coppola ("legend of a cowgirl"); tatyana ali ("everytime"); heather
>nova ("heart and shoulder"); queen latifah ("ladies first"); aretha franklin
>("jump to it"); republica ("ready to go"); the go-go's ("we got the beat");
>indigo girls ("galileo") and sister sledge ("we are family").
>
>the live performance by destiny's child is part of the nba store concert
>series, which features leading pop, rock, hip-hop, jazz, r&b, and country
>recording artists performing live on center court of the store. the nba
>store is located at 5th avenue and 52nd street in manhattan.
>
>nba entertainment (nbae) -- the emmy award-winning production and
programming
>division of the nba and wnba -- is one of the largest suppliers of sports
>television and internet programming in the world.
>
>nbae produces several weekly television shows, including nba inside stuff,
>nba matchup, vintage nba, nba action, wnba action and nba jam; creates
>exclusive content for nba.com and wnba.com; and packages nba and wnba games
>along with highlight and lifestyle shows for distribution to 199 countries
>around the world. nbae also manages publishing ventures for the nba and
wnba.
>
>sfx alphabet city records is a subsidiary of sfx sports, a part of sfx
>entertainment. sfx alphabet city records has created music compilation cds
>for several nba teams, including the chicago bulls, the new york knicks,
>the orlando magic, the utah jazz and the san antonio spurs.
>
>the national alliance of breast cancer organizations (nabco) is the leading
>non-profit information and education resource on breast cancer and a
>nationally recognized force in patient advocacy. nabco provides
information,
>assistance and referral to women at risk, patients and their families,
health
>professionals and the media.
>
>source national alliance of breast cancer organization
>
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 22:13:36 edt
reply-to: sooz911@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: susan burk <sooz911@aol.com>
subject: 3 extra bellingham wa tickets for sale
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i have 3 extra tickets to the indigo girls bellingham wa show. thursday, nov
11, 8:00pm @ the mount baker theatre. i'm pretty sure this one is sold out or
close to it. the tickets are on the main floor, row z, seats 11, 12, & 13
which are just off the right center aisle. price is $114 which is what i paid
for them. email me if you're interested.
if you are interested in just 2 tickets i'll take your name etc but i'd have
to have a person interested in a single ticket before i break them up.
thanks!
susan
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 22:20:26 edt
reply-to: ctofine@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: claudia rollins <ctofine@aol.com>
subject: re: nigc: lesbian movies
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
"boys on the side." great relationships in this movie!
^^^^^^^^^^^^^^^^^^^^^^^^^^^
"by the time she runs down the bluestone path, it doesn't make a bit of
difference what people think or what they believe. there are some things,
after all, that sally owens knows for certain: always throw spilled salt
over your left shoulder. keep rosemary by your garden gate. add pepper to
your mashed potatoes. plant roses and lavender, for luck. fall in love
whenever you can."
--practical magic, alice hoffman
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 19:56:49 pdt
reply-to: karen murphy <murphyslaw77@netscape.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: karen murphy <murphyslaw77@netscape.net>
subject: movies.....
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 8bit
wow midterms suck.
how come no one's mentioned 'heavenly creatures' ? it was a great movie. kate
winslet was awesome.....
-k
____________________________________________________________________
get your own free, personal netscape webmail account today at http://webmail.netscape.com.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 23:11:40 -0400
reply-to: havanamoon <missing_lynx@email.msn.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: havanamoon <missing_lynx@email.msn.com>
subject: re: nigc: lesbian movies
x-to: itsgina21@aol.com
i love the chemistry between gina and jennifer, but detest the violence,
especially the bathroom scene with the pruning shears. i lent my copy of
bound to my friend lea two years ago and haven't seen it since.
everything relative and live nude girls have somewhat similar storylines
involving bittersweet reunions of former college classmates. both have
characters that are very similar to some of my real life friends.
there is also an interesting relationship between ally sheedy and martha
plimpton in chantilly lace.
tim
>my favorite is " bound " with gina gershon!!! she and jennifer tilly make a
>great couple in this one=)
>
>gina
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 23:34:39 -0400
reply-to: "i am 32 flavors and then some..." <tisara@www.webworqs.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "i am 32 flavors and then some..." <tisara@www.webworqs.com>
subject: lesbian films
mime-version: 1.0
content-type: text/plain; charset=us-ascii
a lot of my faves were mentioned, among them incredibly true adventure, go
fish, boys on the side, etc...i can't remember if everythign relative was
mentioned but i loved that. i'm also all about some angelina jolie...so
gia is a fave - so is foxfire *drools* also loving gina gershon, who plays
a dyke in bound as well as showgirls (yes i saw it and if you can get past
all the superficiality of people thinking it's just a t-n-a movie, it's
actually really good)...another fave, which i may not have watched had i
not heard about a production about it at our university is "the children's
hour" - an older flick starring shirley mclane and audrey hepburn...black
and white...defintely a need to see because to me at least, is a
pre-cursor to a lot of today's lesbian flicks...
my two cents, fwtw...
--audra
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
=<www.geocities.com/westhollywood/2670>=*=<www.angelfire.com/pa/tisara/>=
"you said 'i love you.' why is it that the most unoriginal thing we can
say to one another is still the thing we long to hear?"
--jeanette winterson, "written on the body" (p.9)
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 14:03:18 +1000
reply-to: sherlyn koo <sherlyn@fl.net.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sherlyn koo <sherlyn@fl.net.au>
subject: beacon review from jamtv
x-to: ig-news@smoe.org
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
this is a review of one of the beacon shows, from
jamtv (http://www.jamtv.com)...
-sherlyn
---begin forwarded article---
performance: indigo girls
ladies love them. college and high school kids
bond over them. guys earn sensitivity points for
digging them. and when the indigo girls come to
town, even new york city gets a little looser, kinder
and gentler.
taking the stage for the second of a three-night run
at the beacon theatre, indigo girls amy ray and
emily saliers brought out their new band and plenty
of songs from their latest album, come on now
social. opening their set with "go," the girls
brought out joan osborne, who would return
throughout the night to lend her voice and shake her
hips.
the presence of sister joan was in keeping with
come on now social's post-lilith fair vibe, where
jamming with new friends helped keep the music
fresh and flowing. featuring the talents of caroline
dale on cello and multi-instrumentalist carol isaacs
on everything from accordion to djumbek, the band
was there to beautify each song with rich,
emotional shading.
as the years go on, amy looks more and more like
a rock star and emily is looking more and more
like, well, less of a rock star. watch amy's hands
as plays, often moving at twice the speed of her
bandmates', and you'll glimpse what makes her
such an intense performer. their voices still blend
beautifully, emily's smooth like water flowing and
amy's as strong and earthy as wood.
they seemed primed from the start, electric guitars
blaring through "go"'s jarring chords, then switching
over to acoustics for "strange fire"'s call to arms.
audience members, too, were right there in the
moment, taking over the vocals in key spots during
"power of two" and "galileo," as if they had
memorized their parts from 1200 curfews, the
indigo's double live album. new yorkers could
probably learn a thing or two from the band's spirit
of giving. emily took time out during the show to
plug her sister's appearance in a new york city
play. and when they brought out opening act rose
polenzani and sang along to one of her achingly
sweet songs over a lone acoustic guitar and
mandolin, it turned into one of the evenings finest
moments.
"do y'all want to sing the last verse?" emily asked
the crowd during the
everybody-and-their-mother-know's-this-one
anthem, "closer to fine". of course they did. in a
few years, emily and amy won't need to sing any of
the song -- just a count-off will do, and the crowd
will take care of the rest.
during the quieter songs the audience would take
their seats, but a few women standing in the front
couldn't resist standing up to dance, eyes closed in
rapture, as if they were at their own private show.
they could do as they pleased. it was, after all,
girls' night out.
evan schlansky
(october 14, 1999)
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 00:14:27 edt
reply-to: jilly c <jillyc@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jilly c <jillyc@hotmail.com>
subject: nigc. smashing little shindig in nyc thursday
mime-version: 1.0
content-type: multipart/mixed;
boundary="----=_nextpart_000_1abb3391_34722825$684f777"
this is a multi-part message in mime format.
------=_nextpart_000_1abb3391_34722825$684f777
content-type: text/plain; format=flowed
heya. anybody interested in going to this? i think i'll be there, if that,
uh, sweetens the deal or anything. (ha.)
laurie geltman sounds like etheridge
and pamela means is cool as a slurpee.
i'm not in the know about the other two, but hey, take a chance.
come play?
jill
>thursday, october 21 @ 8pm
>best of boston songwriters presented by bmi
>the living room
>corner of stanton & allen
>nyc, ny
>212-533-7235
>line-up: laurie geltman, barbara kessler, nate borofsky, pamela means.
______________________________________________________
get your private, free email at http://www.hotmail.com
------=_nextpart_000_1abb3391_34722825$684f777
content-type: text/html; charset="us-ascii"
content-transfer-encoding: 8bit
<html><!-- onelist -->
<center><a href="http://adforce.imgis.com/?adlink|2.0|2|94688|13|1|adforce;loc=300;" target=_top><img src="http://adforce.imgis.com/?adserv|2.0|2|94688|13|1|adforce;loc=300;" border=0 width=468 height=60><br><font size=1>click here</font></a></center>
<!-- endonelist -->
------=_nextpart_000_1abb3391_34722825$684f777--
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 00:29:16 -0400
reply-to: havanamoon <missing_lynx@email.msn.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: havanamoon <missing_lynx@email.msn.com>
subject: re: lesbian films
shirley maclaine turns in a heart-rending performance in the children's
hour, which was an extremely daring film in its day. a very dear friend who
helped me through a very rough time introduced me to the movie 25 years ago.
i recently found a copy among some previously viewed videos offered for
sale. it took me back to a cherished time, but left me angry that such
prejudice still exists in many quarters....
boys on the side is another favorite. how about even cowgirls get the
blues? i love k.d. on that motorcycle at the end....
tim
>another fave, which i may not have watched had i
>not heard about a production about it at our university is "the children's
>hour" - an older flick starring shirley mclane and audrey hepburn...black
>and white...defintely a need to see because to me at least, is a
>pre-cursor to a lot of today's lesbian flicks...
>
>my two cents, fwtw...
>
>--audra
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 00:33:04 edt
reply-to: ckpjays2@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: ckpjays2@aol.com
subject: ig moment
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
ok so i went out to grab some dinner with a friend of mine, as were about to
leave i heard it!!! the first cords of "peace tonight", so i started to sing
and dance in my seat as she looks around sliding down as if she's not with me
and to make sure no one sees her with me..lol yes that's right i'm a slacker
i haven't gotten the cd yet, well that did it! i looked at her and told her
we had to go to the cd store b/c i needed that cd right this minute! she
looks at me and said "um di , how many times are you going to go and sit
through their show?" uh as many as i can? hehehe...and i'll be doing it again
on the 28th next thurs. in dallas! ok, so we got to the cd store and i'm
roaming all over and there it is at a listening station. well you know i had
to put on the head phones and start to sing and dance, lol she turned red and
fled the scene..lol it was absolutly great!! she doesn't comprehend the ig
experience. oh well thanks for reading, have a great day all!
-di
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: tue, 19 oct 1999 21:45:30 +0000
reply-to: smackenz@scrippscol.edu
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: froglady <smackenz@scrippscol.edu>
subject: re: lesbian films
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
ooh, sorry, couldn't resist saying something (nothing personal)...
i happened to finally see even cowgirls get the blues this summer and i
thought it was a weak, undaring, and confusing adaptation of the book. you can
hardly even see what's-'er-name and bonanza kissing let alone, uh, y'know.
forget the movie (k.d. may be a tasty treat but check her out somewhere
else...hey, that reminds me of salmonberries) and just read the book. okay,
rant done. it's the film freak in me.
-sam (who read sark's nap book this evening and is now having a flood of
memories about all the crazy places she's napped)
havanamoon wrote:
>
> boys on the side is another favorite. how about even cowgirls get the
> blues? i love k.d. on that motorcycle at the end....
>
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 01:14:09 -0500
reply-to: barbara bordner <barbinmn@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: barbara bordner <barbinmn@webtv.net>
subject: ig bbs good grief
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
what do you guys think of the new ig bbs?
once again they've been fiddling around with it, it's driving this user
nutts!!!! why do people always have to try, and make improvements o
things like this. don't those people know when they've got a good thng
going...if it's good it seems they should just leave it alone, instead
of trying to improve it, and end up ruining it instead?.
i'm speaking of the fact that i can only read half the board because the
bozoz over there thought it good idea to put green words on green
background, yellow words on yellow background. oh yeah have some words
on black, but my point is once upon a time we could read and post
legible words on it, now it's gone to hell in a hand basket. what
onearth are these people thinking?
i posted a message similar tio this on there but
it showed up as yellow on yellow....i say to those reading it , "good
luck" i sent in a few messages to the board moderator. i hope people
here do the same.
peace,
barb
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 01:28:30 -0500
reply-to: barbara bordner <barbinmn@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: barbara bordner <barbinmn@webtv.net>
subject: re: ig bbs good grief/in addition
in-reply-to: barbara bordner <barbinmn@webtv.net>'s message of wed, 20 oct
1999 01:14:09 -0500
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
oh yes, and just so people know? i'm not
a computer user. i do webtv. so highlighting doesn't work for me. :-(
barb
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 09:46:18 +0100
reply-to: john bond <john.bond@lineone.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: john bond <john.bond@lineone.net>
subject: re: films
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
well, just a memory jogger : threesome was the film that was on when i
came
out to my mum (not exactly a great coming out experience, but still...)
john.
alisa greenberg wrote:
> not exactly a stricly gay based film, but threesome was really very good.
> a short, little film about three kids, a woman and two men, and the love
> triangle that ensues.
--
"every sperm is sacred,
every sperm is great.
if a sperm is wasted,
god gets quite irate..."
(monty python - the meaning of life)
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 09:28:07 +0100
reply-to: john bond <john.bond@lineone.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: john bond <john.bond@lineone.net>
subject: re: nigc - dyke films
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
well, i read in the advocate a couple of weeks back that the director of "to
wong foo", beeban kidron, was thinking of directing "from potter's field"
sometime soon....
john.
tina crawford wrote:
> speaking of films however, i would love to see them put some of patricia
> cornwells books on film. hell i have been in love with dr scarpettas niece
> lucy for the longest time! okay so maybe its just lust, but ya know, it's
> just not right when your dream girl is fictional!
--
"every sperm is sacred,
every sperm is great.
if a sperm is wasted,
god gets quite irate..."
(monty python - the meaning of life)
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 09:21:43 +0100
reply-to: john bond <john.bond@lineone.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: john bond <john.bond@lineone.net>
subject: re: nigc lesbian movies
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
hmmmmm : i'm thinking about beauiful thing.... along with bedrooms and hallways
(another film by the director of go fish). also boys on the side : great
perfomances (of course....), and ig!!!!!!!!!!!!!!!!!!!! :)
john.
kristen curry wrote:
> i loved high art, but i get sick of certain kinds of
> endings. those of you who've seen it know what i mean.
> those of you who haven't, go rent it, love it, come back
> and we can discuss the ending.
>
> for boy romance try out "beautiful thing". it's a coming
> of age story and a very sweet movie.
>
> always nice to hear somebody else loved "go fish" as much
> as i did :-) i just saw "better than chocolate" and i
> loved it, too. but i'm kind of a sap sometimes.
--
"every sperm is sacred,
every sperm is great.
if a sperm is wasted,
god gets quite irate..."
(monty python - the meaning of life)
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 08:08:13 -0400
reply-to: "i am 32 flavors and then some..." <tisara@www.webworqs.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "i am 32 flavors and then some..." <tisara@www.webworqs.com>
subject: um *drools*...
mime-version: 1.0
content-type: text/plain; charset=us-ascii
ig bbs?
methinks i missed something while i was going crazy over vacation and
whatnot...can someone enlighten me? please? :)
--audra
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
=<www.geocities.com/westhollywood/2670>=*=<www.angelfire.com/pa/tisara/>=
"you said 'i love you.' why is it that the most unoriginal thing we can
say to one another is still the thing we long to hear?"
--jeanette winterson, "written on the body" (p.9)
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 07:30:36 -0500
reply-to: sheryl jones <sljones1@facstaff.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sheryl jones <sljones1@facstaff.wisc.edu>
subject: re: nigc lesbian movies
in-reply-to: <19991019230406.ebgy12280@webmail.worldnet.att.net>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
one of the best "boy" movies i've ever seen is my own private idaho.
depressing as hell, but beautiful
----------------------------------------------------------
sheryl jones
sljones1@facstaff.wisc.edu
cooper seay page: http://www.geocities.com/felidae/cooper/cooper.htm
bootleg page: http://www.geocities.com/felidae/boots.htm
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 07:39:39 -0500
reply-to: sheryl jones <sljones1@facstaff.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sheryl jones <sljones1@facstaff.wisc.edu>
subject: ig bbs
in-reply-to: <pine.bsi.3.96.991020080729.16363b-100000@www.webworqs.com>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
to audra and anyone else who might be interested
the direct link for the ig bbs is:
<http://bbs.sonymusic.com/wwwthreads.pl?action=list&board=indigogirls>
----------------------------------------------------------
sheryl jones
sljones1@facstaff.wisc.edu
cooper seay page: http://www.geocities.com/felidae/cooper/cooper.htm
bootleg page: http://www.geocities.com/felidae/boots.htm
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:40:30 +0100
reply-to: john bond <john.bond@lineone.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: john bond <john.bond@lineone.net>
subject: re: nigc lesbian movies
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
idaho was directed, of course, by gus van sant. he then went on to
direct good will hunting starring matt damon {pant, pant....} and ben
affleck (woof!!!!! woof!!!!! howling at the moon......}....... :)
he also directed even cowgirls get the blues.....
john.
sheryl jones wrote:
> one of the best "boy" movies i've ever seen is my own private idaho.
> depressing as hell, but beautiful
--
"every sperm is sacred,
every sperm is great.
if a sperm is wasted,
god gets quite irate..."
(monty python - the meaning of life)
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 09:05:34 -0400
reply-to: "lane, tara e." <telane@trigon.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "lane, tara e." <telane@trigon.com>
subject: bootlegs
mime-version: 1.0
content-type: text/plain
before ya'll all go out and send these bootleg people ungodly amounts of
money for their unauthorized recordings, which ig sees not a single penny
from (excuse my bad grammar), if you all are patient, in the next year or
two, i promise to offer all of the standards in cd-r, with good artwork and
all, just like the 9:30 deal. i have and will offer the following (but
don't ask me yet):
in w/ the out crowd
nothing to hide
complicated girls
early recordings vol. i, ii, and iii
reverse one live
and if anyone has cd-bootlegs of anything else that is of *very good*
quality that you'd like to share, at a future date i'd be happy to have you
priority mail it to me (as another listee has generously done with her '94
montreal double disc set), and i will grab those wav files and priority mail
the original back to you, and offer it on cdr to the list as a whole.
the key here is patience. if you're willing to wait, you can have the
music, better artwork than what you'd get from a pirate, and better quality
checking, all for the cost of a blank disc, shipping, a mailer, and $1 per
disc for art. plus, most likely i'm going to start buying the discs in bulk
so that you don't even have to send me a disc, you can just send $2 per if
you want so you can save on the mailing cost.
so, with that said, i'll let you guys know that as soon as the bulk of 9:30
requests are down to less than 5/day, i'll be offering that all-acoustic '94
show as a double disc set. i anticipate this will be sometime in the next
few weeks (thanks to sabrina parker for trusting me with her original
discs). then, after that, as promised, i'll be offering the early
recordings - all 3 discs. next, probably in jan., i'll be offering a double
disc set of bumbershoot, hopefully an optimum mix from two different
sources. and then i can get to some of the other pirate stuff that i bought
before i knew anything about the evils of it all.
so wait, and be patient (it's a virtue ya know), and keep the money out of
the evil bootleg pirates' hands. and all will be delivered in good time.
-tara
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 06:20:44 pdt
reply-to: karen murphy <murphyslaw77@netscape.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: karen murphy <murphyslaw77@netscape.net>
subject: re: [lesbian films]
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 8bit
just in case y'all didnt hear me the first time:
heavenly creatures. hasn't anyone seen this?
=0) -k
____________________________________________________________________
get your own free, personal netscape webmail account today at http://webmail.netscape.com.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 09:23:28 edt
reply-to: poprckgrrl@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: poprock grrl <poprckgrrl@aol.com>
subject: re: dyke films (bound)
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
bound isn't even inthe running for a good dyke film...please for the love of
amy and emily don't show this as a dyke fim...it's a heterosexual males
fantasy and just not a good depiction of lesbians like go fish, all over me,
watermelon woman, or the 2 girls in love (among others)
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 09:34:24 -0700
reply-to: lisa tatonetti <tatonetti.2@osu.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lisa tatonetti <tatonetti.2@osu.edu>
subject: indigohio
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hey folks,
i'm not sure if venue corrections on michigan and columbus have been posted
yet. and there's a dayton date! woo hoo! (this comes to me from friend
and ex-listee, alycia b.)
>the pollstar site might be correct on this one.
>they list the ig tour like this:
>
>12/10 ypsilanti eastern michigan university
>12/11 columbus ohio memorial auditorium (vets)
>12/13 dayton ohio memorial auditorium
happy day,
lisa
ohio state university
english department
421 denney hall
164 w. 17th ave.
columbus, oh 43210
(614) 292-6065
"the best thing you've ever done for me is to help me take my life less
seriously, it's only life afterall."--emily saliers
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 10:08:54 edt
reply-to: subcityii@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: subcityii@aol.com
subject: lesbian films
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
even though i'm a straight guy, i watch a lot
of lesbian films, here are some of my favorites:
"desert hearts"
"bound"
"...two girls in love"
"personal best"
"better than chocolate"
"high art"
a new one is opening soon called "boys don't cry" that
i hear is very good.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 10:03:01 -0400
reply-to: hicktruckdriver <dcw2428@osfmail.isc.rit.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: hicktruckdriver <dcw2428@osfmail.isc.rit.edu>
subject: re: [lesbian films]
x-to: karen murphy <murphyslaw77@netscape.net>
in-reply-to: <19991020132044.8910.qmail@www0l.netaddress.usa.net>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
on wed, 20 oct 1999, karen murphy wrote:
> just in case y'all didnt hear me the first time:
> heavenly creatures. hasn't anyone seen this?
yes. melanie lynskey. *drool* ;)
isn't peter jackson doing the new lord of the rings film?
darius
"i'm marked for death, and they send me on the road with a pr nerd."
- allegra geller, "existenz"
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 10:35:04 -0400
reply-to: bean@neu.edu
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: elaine bean <bean@neu.edu>
organization: northeastern university, faculty senate office, 442 ry,
360 huntington ave., boston, ma 02115
subject: re: dyke films (bound)
x-to: poprckgrrl@aol.com
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
poprock grrl wrote:
>
>it's a heterosexual males fantasy
what? i beg to differ. why do you dismiss it as a male fantasy?
because the two lesbians in the story shared the screen with males?
because the lesbians in the movie weren't totally depicted in their
lesbian culture/surroundings? or because one of the main characters
slept with men, but really loved women?, which is not as uncommon as you
seem to think. one example, many prostitutes live this lifestyle -
actually if you think about it, vi was certaily prostituting herself,
but i digress.
> and just not a good depiction of lesbians like go fish, all over me,
> watermelon woman, or the 2 girls in love (among others)
i tend to agree here. the focus of the movie wasn't on lesbianism per
say, rather it was about 2 women who happened to be lesbians, and the
story line focused on the swindle, but i wouldn't dismiss the movie as a
"male fantasy". i didn't think it it was that at all. i thought it was
very realistic - had the ending been something trivial like "because of
the love of a good man, vi realizes the errors of her way and is swept
off her feet by one of the men in the movie, and lives a heterosexual
life" i would say yes, this is a fantasy.
elaine
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 09:48:33 -0600
reply-to: "sarah t. rosenblum" <strosenblum@students.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "sarah t. rosenblum" <strosenblum@students.wisc.edu>
subject: nigc lesbian movies
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
why, because bound has a plot and actual semi-exceptable acting unlike most
lesbian movies?
someone or other wrote:
>>bound isn't even inthe running for a good dyke film...please for the love of
amy and emily don't show this as a dyke fim...it's a heterosexual males
fantasy and just not a good depiction of lesbians like go fish, all over me,
watermelon woman, or the 2 girls in love (among others)
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 09:53:32 -0600
reply-to: "sarah t. rosenblum" <strosenblum@students.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "sarah t. rosenblum" <strosenblum@students.wisc.edu>
subject: oops
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
i spelled acceptable wrong. sorry.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 10:52:41 edt
reply-to: mariedemi@cs.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: marie demiguel <mariedemi@cs.com>
subject: one ticket for friday's 10/22 show athens, ga
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
please email me if anyone is interested.
marie
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:07:06 gmt
reply-to: that loud girl <strange_fire66@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: that loud girl <strange_fire66@hotmail.com>
subject: nigc:lesbian movies
mime-version: 1.0
content-type: text/plain; format=flowed
i'd have to give my nod to boys on the side, as i watched it two times in a
row, and bawled both times. foxfire's also good, and, since i haven't seen
it mentioned yet, chasing amy. not a lesbian/bi- movie, per se, but i see
so much of myself in that film its unbelievable...
______________________________________________________
get your private, free email at http://www.hotmail.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:06:40 +0000
reply-to: kz123@att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristen curry <kz123@att.net>
subject: nigc- texas motels
hey there texans,
i'll be in austin the nights of the 26 and 27 and dallas
the night of the 28. i'm looking for good routes from
colorado springs to austin for the first two shows since
i'm driving but even more than that i'd like
recommendations for budget budget motels that are
reasonably close to the backyard or the bronco bowl and
are in reasonably safe neighborhoods. also easy to find
for this out of towner...
help help help. any suggestions appreciated!
i've got a car reserved and i'm really coming down. wooo
hoo.
thanks y'all.
kristen
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 11:20:53 edt
reply-to: poprckgrrl@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: poprock grrl <poprckgrrl@aol.com>
subject: more nigc films
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
first let me say... i heard you about heavely creatures!!! :) that film is
amazing!
second let me say
wow, everybody gets so defensive about bound...
as a movie it was ok...gina gershon always makes it worth the price of
admission... ;)
however...this whole thread started because someone asked what would be some
good dyke films...and i personally don't think it's a good dyke film because
a) it was written and directed by men
b) it doesn't show the experiences of being a dyke
c) it doesn't show any dyke culture...unless you consider sex part of our
culture...last time i checked being a dyke wasn't all about sex though...
it's not the kind of thing you would want to show at a gathering such as the
one the girl was talking about...
at a sort of mini film fest featuring dyke movies, the idea is to show dyke
movies...( i thought that was the point anyway)
go fish, desert hearts, watermelon woman, 2 girls in love, when night is
falling etc are much better choices...
i know lots of dyke movies suck...bar girls is the worst queer move i ever
made with claire of the moon a close 2nd, ic an't deny that some acting is
questionable (like in everything relative and even go fish (although i love
this movie despite it's crummy acting because it is a very good
representation of lesbians and what happens on a day to day basis...
so sue me for having an opinion about bound :)
film freak and big f&*%ing dyke
-heather
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:32:42 gmt
reply-to: that loud girl <strange_fire66@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: that loud girl <strange_fire66@hotmail.com>
subject: re: best way to buy out of state tickets for chicago???
mime-version: 1.0
content-type: text/plain; format=flowed
its a benefit show, but they'll be singing their own songs--each year, wxrt
has some big-names come in to do their "holiday concerts for the kids"--last
year, for example, it was patti smith.
>is the chicago concert a "regular" concert, or is it just a christmas
>show? someone posted info that it's for a children's charity, which is so
>cool, but as much as i love the girls, i don't know if i'd fly all that way
>to hear them sing christmas songs...
______________________________________________________
get your private, free email at http://www.hotmail.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 11:31:10 edt
reply-to: erinsuepoo@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "<erin carroll>" <erinsuepoo@aol.com>
subject: age poll update
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
hello everyone!
as of this lovely, rainy, cold, vermont morning...there have been almost 100
responses to the age poll. i will now ask that anyone who has yet to
respond...even those who usually lurk ;)...to please do so before friday
(10/22) as i would like to post the results that day. remember...each and
every one of you count! so please "go go go" and be heard =)
just a reminder...we are asking for age, gender and years listening to the
girls. i have had a request or two for sexual pref. but it is kinda too late
in the game to add that...(sorry to those that requested). this has been a
blast...it is so nice to get to know a bit about y'all!
take care,
erin sue
erinsuepoo@aol.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 11:43:59 -0400
reply-to: havanamoon <missing_lynx@email.msn.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: havanamoon <missing_lynx@email.msn.com>
subject: re: nigc lesbian/gay movies
i can't decide whether to love or hate "my own private idaho." the
photography is exquisite, and there are some wonderfully poignant moments,
but river phoenix's depiction of narcolepsy strikes very close to home (my
youngest son is epileptic). i also tire of hollywood's portayal of young
gay men as street hustlers. lukas haas is great in "johns", but the
storyline is even more depressing than "idaho".
"all over me" is much more sensitive in its portrayal of young gay males,
but still one of the most engaging characters in the film ends up murdered.
what i'd really love to see is the male equivalent of
'two girls in love."
"wild reeds" is a french coming-of-age film with a very sympathetic
treatment of a young man coming to grips with his sexuality.
"losing chase" is another moving film that features a slow-developing
relationship between two women, but i hated the ending.....
tim
-----original message-----
from: sheryl jones <sljones1@facstaff.wisc.edu>
to: indigo-girls@netspace.org <indigo-girls@netspace.org>
date: wednesday, october 20, 1999 8:31 am
subject: re: nigc lesbian movies
>one of the best "boy" movies i've ever seen is my own private idaho.
>depressing as hell, but beautiful
>----------------------------------------------------------
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 11:39:55 -0400
reply-to: "i am 32 flavors and then some..." <tisara@www.webworqs.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "i am 32 flavors and then some..." <tisara@www.webworqs.com>
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
subject: lesbian flicks
mime-version: 1.0
content-type: text/plain; charset=us-ascii
i loved bound, for whatever reasons - and it can be shown for the lesbian
content because not all lesbians live the lives depicted in the lesbian
flicks i have seen...we're all different...so what if it was directed by a
man? there are lesbian directors that have had movies about gay men, and
straight people - doesn't make it any less valid; just a different
perspective. and gina gershon does make it worth it *drools*
*ahem* anyways, i can't wait to see boys don't cry...i have been
quasi-fascinated with the brandon teena story since i first read about it.
i just got back from vacation and i picked up a bunch of queer mags while
i was there so i was reading a bunch of different perspectives about it on
the way back...looks very good...*bounces*
*goes in the corner to calm down*
--audra
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
=<www.geocities.com/westhollywood/2670>=*=<www.angelfire.com/pa/tisara/>=
"you said 'i love you.' why is it that the most unoriginal thing we can
say to one another is still the thing we long to hear?"
--jeanette winterson, "written on the body" (p.9)
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 11:44:49 -0400
reply-to: "lane, tara e." <telane@trigon.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "lane, tara e." <telane@trigon.com>
subject: re: nigc lesbian/gay movies
mime-version: 1.0
content-type: text/plain
can't believe nobody's mentioned 'torch-song-trilogy', which is one of my
all-time favorites, even though it's about men, sad and almost too real.
it's the movie you should give to your parents if they don't get it. i
should give it to mine.
-tara
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 08:52:15 -0700
reply-to: "malecki, nancy" <maleckin@fisher-price.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "malecki, nancy" <maleckin@fisher-price.com>
subject: johnny rotten boot update/ film suggestion
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
greetings again!
i have received, (as predicted) many requests for the amherst boot
containing johnny rotten. a few people have offered to help tape and i will
be contacting them about it. i should be posting the particulars tomorrow.
many thanks to those who offered to help, you'll be hearing from me soon.
if i have contacted you with my address, ignore the post tomorrow, and just
deal with me. is this clear???
i appreciate your patience, as this is my first time!!
i have three suggestions for films, forgive me if they have been mentioned,
(i am a little frazzled today).
salmonberries- little slow
losing chase- loved it!!
i heard the mermaid singing- fun and goofy!
thanks again for all of your patience re: the tape, i am trying to be as
thorough as possible!!
nancy
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:55:24 gmt
reply-to: that loud girl <strange_fire66@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: that loud girl <strange_fire66@hotmail.com>
subject: nigc:boys don't cry
mime-version: 1.0
content-type: text/plain; format=flowed
since i saw someone bring it up, i thought i'd comment...
i saw boys don't cry last week at a film festival, and found it to be one of
the most disturbing movies i've seen in the recent past, and also a
well-made love story. however, i don't think its a "lesbian" movie.
"brandon" is biologically a woman, but identifies as a man throughout the
film (and is darn convincing, if you ask me). his/her character also
specifically states that he/she is "not a dyke".
shel
______________________________________________________
get your private, free email at http://www.hotmail.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 11:59:25 -0400
reply-to: havanamoon <missing_lynx@email.msn.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: havanamoon <missing_lynx@email.msn.com>
subject: re: nigc:lesbian movies
x-to: that loud girl <strange_fire66@hotmail.com>
i still can't watch boys on the side without getting emotional. angelina
jolie is great in foxfire, but she never should have ended up leaving town
alone.....
i watched chasing amy in the theater with a strong sense of deja vu until
the male character became such a jerk...
tim
-----original message-----
from: that loud girl <strange_fire66@hotmail.com>
to: indigo-girls@netspace.org <indigo-girls@netspace.org>
date: wednesday, october 20, 1999 11:08 am
subject: nigc:lesbian movies
>i'd have to give my nod to boys on the side, as i watched it two times in a
>row, and bawled both times. foxfire's also good, and, since i haven't seen
>it mentioned yet, chasing amy. not a lesbian/bi- movie, per se, but i see
>so much of myself in that film its unbelievable...
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 11:55:54 -0400
reply-to: "i am 32 flavors and then some..." <tisara@www.webworqs.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "i am 32 flavors and then some..." <tisara@www.webworqs.com>
subject: boys don't cry
mime-version: 1.0
content-type: text/plain; charset=us-ascii
true, brandon viewed himself as a man, and so techinically it would be a
heterosexual thing, but for me, it can be included in the discussion
because the director is a lesbian, and for all intents and purposes,
brandon probably would have ended up being transgendered had he
lived...but since he didn't, it was still a woman to woman relationship,
regardless. imo, anyways...
--audra
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
=<www.geocities.com/westhollywood/2670>=*=<www.angelfire.com/pa/tisara/>=
"you said 'i love you.' why is it that the most unoriginal thing we can
say to one another is still the thing we long to hear?"
--jeanette winterson, "written on the body" (p.9)
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 12:09:51 -0400
reply-to: havanamoon <missing_lynx@email.msn.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: havanamoon <missing_lynx@email.msn.com>
subject: re: more nigc films
that's why i love "everything relative", the characters and situations are
very real, although somewhat dated.
anyone ever see "hotel new hampshire?" strange movie....
-----original message-----
from: poprock grrl <poprckgrrl@aol.com>
to: indigo-girls@netspace.org <indigo-girls@netspace.org>
date: wednesday, october 20, 1999 11:22 am
subject: more nigc films
>i know lots of dyke movies suck...bar girls is the worst queer move i ever
>made with claire of the moon a close 2nd, ic an't deny that some acting is
>questionable (like in everything relative and even go fish (although i love
>this movie despite it's crummy acting because it is a very good
>representation of lesbians and what happens on a day to day basis...
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 09:38:11 -0700
reply-to: hawke2@email.msn.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: ryan blackhawke <hawke2@email.msn.com>
subject: re: more nigc films
in-reply-to: <0.f1984803.253f37d5@aol.com>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
> -----original message-----
>
> however...this whole thread started because someone asked what
> would be some
> good dyke films...and i personally don't think it's a good dyke
> film because
>
> a) it was written and directed by men
and i thought it was better than many of the movies i saw writeen and
directed by women. your point?
> b) it doesn't show the experiences of being a dyke
most of the movies i've seen relating to dykedom doesn't come anywhere close
to my experiences as a dyke, or the experiences of just about everyone i
know who is a dyke.
> c) it doesn't show any dyke culture...unless you consider sex part of our
> culture...last time i checked being a dyke wasn't all about sex though...
don't you read falwell's literature? according to him, we are all about sex
and want to prey upon those fine upstanding christian women. :-^
seriously though...what is dyke culture? bar-hopping and wife-swapping?
living with 4 or 5 other people because we are too poor to make it on our
own? (yes i know poverty is a huge problem in the dyke community, as it is
in the rest of our society)? alot of the movies out there would have us
believe we are lay in wait for the next str8 grrl to come along so we can
recruit her.
ryan
a bitch- er, make that butchy dyke (or at least she plays one on the
internet)
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 16:39:34 +0000
reply-to: kz123@att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristen curry <kz123@att.net>
subject: re: lesbian films
hey all,
i saw a production of the children's hour last year. the
big problem with that play/movie, and an ongoing problem
i have with queer film in general is dead dykes. dead
gay guys too. good christ. we drop like flies.
i love some of the movies i do because nobody's died a
tragic death at the end. honestly, even in some great
les/bi/gay/trans films what disturbs me the most is the
message it sends to our youth. that your love is doomed.
that your life is doomed. that you will suffer, be brave,
and love only to end up on a slab in a morgue. ultimately
you will be sacrificed to the world's ignorance,
misunderstanding, fear and hatred.
it's not romantic.
(although it does work in some movies, and i love some of
the movies it happens in.)
kc
> shirley maclaine turns in a heart-rending performance in the children's
> hour, which was an extremely daring film in its day. a very dear friend who
> helped me through a very rough time introduced me to the movie 25 years ago.
> i recently found a copy among some previously viewed videos offered for
> sale. it took me back to a cherished time, but left me angry that such
> prejudice still exists in many quarters....
>
> boys on the side is another favorite. how about even cowgirls get the
> blues? i love k.d. on that motorcycle at the end....
>
> tim
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 12:48:32 edt
reply-to: lisa071573@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lisa r <lisa071573@aol.com>
subject: kate winslet, some igc ...
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
well someone should have mentioned that my kate was in heavenly creatures!!
i'll go rent the thing tonight :) i liked bound - beautiful girls and
beuatiful cinematography - you gotta get past the mob stuff though...didn't
like go fish - couldn't get past the bad acting...
does anyone know what happened to the sf warfield date?? someone else
mentioned that the girls are going to be at humbolt on the date they were
supposed to be in sf...i was hoping myabe it was changed to a different date
- the warfield is a neat little place :)
lisa
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 12:46:29 -0400
reply-to: havanamoon <missing_lynx@email.msn.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: havanamoon <missing_lynx@email.msn.com>
subject: online film source and the most disturbing movie ever nigc
a good source for information on films with gay/lesbian content is
http://wolfevideo.com .....
i rented "kids" a few months back out of curiosity. i can't recall a more
disturbing film....
tim
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 12:58:50 edt
reply-to: jennie church <jennieum@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jennie church <jennieum@hotmail.com>
subject: ann arbor show is misprint
mime-version: 1.0
content-type: text/plain; format=flowed
i saw someone kind of alluded to this earlier, but the ann arbor show on the
official site is a misprint. i e-mailed the university of michigan ticket
office and they said they had no idea why they put this info up, but the ig
were trying to book a show at eastern michigan. i guess they succeeded. so
they are no longer a 5 minute walk away. darn it!
"i ran as hard as i could, i still ended up here. and it's alright."
emily saliers, indigo girls
______________________________________________________
get your private, free email at http://www.hotmail.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:06:36 -0400
reply-to: bean@neu.edu
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: elaine bean <bean@neu.edu>
organization: northeastern university, faculty senate office, 442 ry,
360 huntington ave., boston, ma 02115
subject: re: online film source and the most disturbing movie ever nigc
x-to: havanamoon <missing_lynx@email.msn.com>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
havanamoon wrote:
>
> a good source for information on films with gay/lesbian content is
> http://wolfevideo.com .....
>
> i rented "kids" a few months back out of curiosity. i can't recall a more
> disturbing film....
had i seen "kids", i'm sure it would top my list but i wouldn't watch it
for the huge "disturb" factor. i did, however, see "fear" - is this the
right name? the one with donnie wahlburg? oh, i found that very
disturbing. the rape/murder scene in "dead man walking" was very
upsetting, as was the whole movie - and, of course "clockwork orange"
heads the list for all time unsettling movie. i even freaked when i saw
better than chocolate - that scene where the trans-gendered person gets
beat up in the women's room by a lesbian.
any depiction of cruelty/violence/rape/murder bothers me to no end.
elaine
elaine
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:18:57 edt
reply-to: anna banana <aeigfolk@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: anna banana <aeigfolk@hotmail.com>
subject: re: kate winslet, some igc ...
x-to: lisa071573@aol.com
mime-version: 1.0
content-type: text/plain; format=flowed
<someone else mentioned that the girls are going to be at humbolt on the
date they were supposed to be in sf...>
ack! holy spelling faux pas, batman! let us not forget the "d" in
humboldt, thank you very much. and yes, they are indeed confirmed to
perform in eureka, ca on november 8. sorry to you sf/warfield fans. but we
finally got 'em up here!
______________________________________________________
get your private, free email at http://www.hotmail.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:20:30 edt
reply-to: scarybiker@cs.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: rick b sayre <scarybiker@cs.com>
subject: re: nigc lesbian movies
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 10/20/99 8:31:53 am eastern daylight time,
sljones1@facstaff.wisc.edu writes:
> one of the best "boy" movies i've ever seen is my own private idaho.
> depressing as hell, but beautiful
oh yes! also, parting glances is another film i haven't seen mentioned yet...
maurice... beautiful thing... object of my affection... oh, and the hanging
garden. of course there's also the living end, but anything by araki is a
pretty crazy movie.
speaking of "threesome"- i saw that movie with my mom! define weird.
anyone remember the television show "relativity"? one of the main characters
had a sister who was a lesbian & there was this really cute scene involving
an earthquake simulator...? ok it could just be me, but i thought it was
really romantic.
rick
*i guess it comes apart so little by little
you don't know you're there till you're stuck in the middle* -emily saliers
<a href="http://members.aol.com/rbsayre/cheese.html">sweet page o'mine</a>
*there ain't no way i'm gonna let this heart mend* -amy ray
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:26:30 edt
reply-to: scarybiker@cs.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: rick b sayre <scarybiker@cs.com>
subject: re: [lesbian films]
x-to: murphyslaw77@netscape.net
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 10/20/99 9:22:20 am eastern daylight time,
murphyslaw77@netscape.net writes:
> just in case y'all didnt hear me the first time:
> heavenly creatures. hasn't anyone seen this?
i've got it on laserdisc. :) excellent movie.
afterthought re: gus van sant... lest we forget to die for in which all over
me's allison folland (love her) plays a girl with a crush on nicole kidman :)
and has anyone mentioned velvet goldmine yet?? as a balehead i must.
and also thought i'd mention alfred hitchcock's rope... which is a dark, dark
comedy that centers around a couple of gay men. movies such as this are never
made today *sigh*
however (off-off topic)... has anyone seen existenz? i rented it last night &
was really surprised by it... i just expected it to be so-so, but it caught
me off guard and left me with my jaw on the floor. not to mention my
pseudo-crush on jennifer jason leigh.
*i guess it comes apart so little by little
you don't know you're there till you're stuck in the middle* -emily saliers
<a href="http://members.aol.com/rbsayre/cheese.html">sweet page o'mine</a>
*there ain't no way i'm gonna let this heart mend* -amy ray
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:24:25 -0400
reply-to: erica weinstein <eweins1@po-box.mcgill.ca>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: erica weinstein <eweins1@po-box.mcgill.ca>
organization: a woman without a man is like a fish without a bicycle
subject: lebian film
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
i just want to thank everyone for their input on lesbian films. i have
compiled a list from what everyone said. i tried to put only purely
lesbian films on the list, but i did have to add some cult faves like
bound. i also left the painfully bad, but none the less classic,
lesbian films on the list like desert hearts (everyone makes mistakes).
maybe we could discuss lesbian books too. i am trying to get alison
bechdel, the author of dykes to watch out for, to speak at dyke days but
i think she is way too expensive. she sent me a personal e-mail about
it *sigh* and i am going to have to turn her down. i am so
disappointed.
i love this list!
erica
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:33:52 edt
reply-to: scarybiker@cs.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: rick b sayre <scarybiker@cs.com>
subject: re: more nigc films
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 10/20/99 12:08:42 pm eastern daylight time,
missing_lynx@email.msn.com writes:
> anyone ever see "hotel new hampshire?" strange movie....
natassja kinski in a bear suit? yes... *very* strange movie. someone actually
gave me a jodie foster video package that included hotel new hampshire along
with little man tate & silence of the lambs... i had never seen it before.
and um, since...
:)
*i guess it comes apart so little by little
you don't know you're there till you're stuck in the middle* -emily saliers
<a href="http://members.aol.com/rbsayre/cheese.html">sweet page o'mine</a>
*there ain't no way i'm gonna let this heart mend* -amy ray
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:35:55 -0400
reply-to: kelly <khager@shore.intercom.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kelly <khager@shore.intercom.net>
subject: re: nigc lesbian movies
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
>object of my affection
yes!!!!!! i love that movie. :) the last time i saw it, i was watching it
with my friend chad, while we were waiting for his boyfriend to call. i was
crying, of course, and he was totally unmoved. guys. :p
wow, that was so pointless. sorry. :)
kelly
"it's too corny to cry." amy ray; "joking."
"i missed ten million miles of road i should have seen." emily saliers;
"love's recovery."
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:38:29 edt
reply-to: scarybiker@cs.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: rick b sayre <scarybiker@cs.com>
subject: re: online film source and the most disturbing movie ever nigc
x-to: bean@neu.edu
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 10/20/99 1:08:34 pm eastern daylight time, bean@neu.edu
writes:
> and, of course "clockwork orange"
> heads the list for all time unsettling movie.
clockwork orange is one of 2 films i could just not watch entirely. the other
was an awful movie called strangeland, which holds the distinction of being
the only film i've ever walked out on.
the doom generation is another really disturbing film. and of course natural
born killers. actually, i'm finding that as i grow older a lot of the movies
i'd seen before ("seven", "silence of the lambs") are disturbing me more than
they originally had... possibly due to really starting to study films and
look deeper into the stories, realizing the consequences of the characters
actions... and not just... watching the screen.
*shrug*
rick
*i guess it comes apart so little by little
you don't know you're there till you're stuck in the middle* -emily saliers
<a href="http://members.aol.com/rbsayre/cheese.html">sweet page o'mine</a>
*there ain't no way i'm gonna let this heart mend* -amy ray
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:38:47 edt
reply-to: poprckgrrl@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: poprock grrl <poprckgrrl@aol.com>
subject: boys dont cry
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i saw boys dont cry at the opening night of the dc gay/lesbian film fest (see
told ya i was a film freak :) ) and it was amazing! this movie will affect
you. it's wonderfully acted and it is a must see.
it's opening friday nationwide int eh top 20 markets...not sure what they
consider the top 20 markets though...
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 12:20:28 -0600
reply-to: "amy m." <indigrrl@selway.umt.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "amy m." <indigrrl@selway.umt.edu>
subject: queer film recommendations imho of course and nigc
x-to: froglady <smackenz@scrippscol.edu>
in-reply-to: <380ce664.416a2b39@scrippscol.edu>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
on tue, 19 oct 1999, froglady wrote:
> ooh, sorry, couldn't resist saying something (nothing personal)...
> i happened to finally see even cowgirls get the blues this summer and i
> thought it was a weak, undaring, and confusing adaptation of the book. (k.d. may be a tasty treat but check her out somewhere
> else...hey, that reminds me of salmonberries)
ok, not to offend, but salmonberries? ok...no. how boring was that? save
for the brief shot of k.d. nude in the library, what a sleeper. also hated
even cowgirls get the blues, but do read the book. tom robbins is a
genius. i would also have to respectfully disagree once again with
personal best and desert hearts.
now, just so you all don't think i'm starting to sound like a grouchy old
lady or something...better than chocolate is a really good (perhaps even
great) bad movie (call me a sucker for the romance, but it makes you
overlook the boom mike popping into a couple scenes).
the incredibly true adventures...randy, what more can you say? my favorite
movie in the world.
go fish (i'm so glad to find other people who loved that movie, most of
the people i know hated it.) loved all over me, too.
for the fairer sex :0), beautiful thing is the sweetest and billy's
hollywood screen kiss is really good too. has anyone seen that relatively
new one, trick? with neve campbell's brother? if you have, i'd like to
know what you thought.
ok i'm done,
amy m.
&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&
"we are not empty-headed celebrities."
-the goddess, amy ray
"women together is a powerful thing, especially when you join it with
music."
-the goddess, emily saliers
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 18:30:31 +0000
reply-to: kz123@att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristen curry <kz123@att.net>
subject: re: nigc lesbian/gay movies
> what i'd really love to see is the male equivalent of
> 'two girls in love."
then you'll really love "beautiful thing". it's much
better made than "2 girls in love" - much higher quality
movie, finer acting, but with the heart of "2 girls".
it's a great little movie.
kc
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 18:59:33 +0000
reply-to: kz123@att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristen curry <kz123@att.net>
subject: re: [lesbian films]
"swoon" hasn't been mentioned yet. murdering gay boys.
"heavenly creatures" was a great movie, but ah, hard to
watch. very hard to watch.
kc
> in a message dated 10/20/99 9:22:20 am eastern daylight time,
> murphyslaw77@netscape.net writes:
>
> > just in case y'all didnt hear me the first time:
> > heavenly creatures. hasn't anyone seen this?
>
> i've got it on laserdisc. :) excellent movie.
>
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 19:05:30 +0000
reply-to: kz123@att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristen curry <kz123@att.net>
subject: re: online film source and the most disturbing movie ever nigc
i thought the best best best thing about better than
chocolate was the way it dealt with the trangendered
character and the way those issues play in the community.
very compassionate, honest and humanizing.
i thought a lot of the things that happen to judy in
that are heartbreakingly common. and i loved her song...
"i am not a f_cking dragqueen"
i have one dyke friend who has a giant problem dealing
with transgendered people, especially m >> f
transgendered folks. she's not cruel - she's a very
caring person. she just has trouble with it.
i'm dragging her ass to that movie.
cheers all,
kc
> havanamoon wrote:
> >
> > a good source for information on films with gay/lesbian content is
> > http://wolfevideo.com .....
> >
> > i rented "kids" a few months back out of curiosity. i can't recall a more
> > disturbing film....
>
> had i seen "kids", i'm sure it would top my list but i wouldn't watch it
> for the huge "disturb" factor. i did, however, see "fear" - is this the
> right name? the one with donnie wahlburg? oh, i found that very
> disturbing. the rape/murder scene in "dead man walking" was very
> upsetting, as was the whole movie - and, of course "clockwork orange"
> heads the list for all time unsettling movie. i even freaked when i saw
> better than chocolate - that scene where the trans-gendered person gets
> beat up in the women's room by a lesbian.
> any depiction of cruelty/violence/rape/murder bothers me to no end.
>
> elaine
>
> elaine
>
> --
> all listserv commands should be sent to listserv@netspace.org.
> to unsubscribe issue the command: signoff indigo-girls
> for help write to indigo-girls-request@netspace.org.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 10:34:09 -0700
reply-to: benjamin carl kerrick <kerricbc@whitman.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: benjamin carl kerrick <kerricbc@whitman.edu>
subject: gay films (nigc)
in-reply-to: <19991020172630z37403-1483+493@brimstone.netspace.org>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
bent is another beautiful gay film- set in nazi germany, it follows the
life of a gay man who finds love at dachau. its incredible.
ben
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:01:44 edt
reply-to: indigopony@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: indigopony@aol.com
subject: movies (nigc) and folk (igc)
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
not to flame anyone, but...it's been a couple days now, so could we please
take the general nigc movie discussions to private mail soon? it wouldn't
bother me much except that i feel like i'm seeing the same few posts over and
over in this thread. yes, i do know how to use my delete key, too. thanks,
y'all...(and yes, i enjoy lesbian movies as much as the next
dyke/queer-friendly person--good thing i go to smith ;)
for some igc: i played an all-ig set on my radio (folk) show last weekend in
honor of their visits to ma and my recent ig-experiences (being second row,
meeting emily, etc.), and i'm having a fairly hard time picking out what
constitutes *folk* on the new album...so far, i've played gone again and soon
be to nothing. i suppose andy, faye tucker (a.k.a. woody guthrie's john
henry) and ozilline would count, too? the more em and amy grow and change as
lyricists and musicians, the harder their music is to classify by genre
(which is a *good* thing, imo).
sending good indigo karma,
carrie
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:02:37 -0400
reply-to: kelly fairbairn <fairbk@sage.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kelly fairbairn <fairbk@sage.edu>
subject: re: online film source and the most disturbing movie ever nigc
x-to: rick b sayre <scarybiker@cs.com>
in-reply-to: <0.d05615c0.253f5815@cs.com>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
on wed, 20 oct 1999, rick b sayre wrote:
> in a message dated 10/20/99 1:08:34 pm eastern daylight time, bean@neu.edu
> writes:
>
> > and, of course "clockwork orange"
> > heads the list for all time unsettling movie.
>
> clockwork orange is one of 2 films i could just not watch entirely. the other
> was an awful movie called strangeland, which holds the distinction of being
> the only film i've ever walked out on.
here's a me-too. i walked out during co the first fifteen minutes and did
not return to the theater. i sat in the lobby and read whatever i could
get my hands on until my friends were done watching the movie.
i used to manage a small video store, and used to watch a ton of movies,
but now i don't have the taste for them anymore. too much violence, too
much nakedness and not enough story. i don't know. sometimes i feel old
for my age. (24 tomorrow. :)
btw, in case anyone cares, bound was one of the most rented movies we had
on our new release wall way back when. the owner wouldn't let me take it
down for months because it rented so well. personally, i didn't care for
it, though gina gershon (sp?) is a hottie.
anyway, back to work for me,
kelly
%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%
%^ kelly fairbairn %^
^% ill dept. ^%
%^ sage troy campus library %^
^% fairbk@sage.edu ^%
%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 14:28:24 -0600
reply-to: "sabrina d. parker" <parkers@civerolo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "sabrina d. parker" <parkers@civerolo.com>
subject: ozilline
mime-version: 1.0
content-type: text/plain
speaking of ozilline ... does anyone have any idea what the chorus/backing
vocals are saying during the song?
also, does anyone else hear amy's grandmother continue to speak during the
entire song? i can hear it on headphones, although i can't make out what
she's saying. i think it's fascinating.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:25:21 -0500
reply-to: "jennifer k. parker" <jkp30@juno.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "jennifer k. parker" <jkp30@juno.com>
subject: nigc - lesbian films
mime-version: 1.0
content-type: text/plain
content-transfer-encoding: 7bit
>>poprock grrl wrote: "last time i checked being a dyke wasn't all about
sex though..."
i have tried and tried to explain this to my mom, but somehow i am
failing because she brought it up again in front of my brother as
recently as last week...as in "jen says being a gay isn't only about sex"
to which my brother responded "of course it is!!!"
what can i say to them to let them (and others) better understand what i
mean when i say that?! i am obviously not saying the right thing. so
when i saw that poprock grrl wrote that i was like "see!!!!!" *grin*
anyway, maybe one of you can help.
thanks in advance.
jennifer
*counting down the hours til ig in dallas...have i mentioned i have 8th
row emily side seats??? wheeeeeeee!!!!!!!!!! *
___________________________________________________________________
get the internet just the way you want it.
free software, free e-mail, and free internet access for a month!
try juno web: http://dl.www.juno.com/dynoget/tagj.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 16:31:59 -0400
reply-to: bean@neu.edu
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: elaine bean <bean@neu.edu>
organization: northeastern university, faculty senate office, 442 ry,
360 huntington ave., boston, ma 02115
subject: re: gay films (nigc)
x-to: benjamin carl kerrick <kerricbc@whitman.edu>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
benjamin carl kerrick wrote:
>
> bent is another beautiful gay film- set in nazi germany, it follows the
> life of a gay man who finds love at dachau. its incredible.
post-happy today - actually, work avoidance is more like it.
three good gay films:
love, compassion and valour - george costanza from seinfeld was in it.
you don't know dick - documentary about the transgendered community,
male to female
jeffrey - captain picard? from star trek was in this. so was one of
the brothers from that show "wings"
elaine
elaine
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 16:27:37 -0400
reply-to: nancy lambert <nlambert@inter-science.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: nancy lambert <nlambert@inter-science.com>
subject: re: ozilline
x-to: "sabrina d. parker" <parkers@civerolo.com>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
oh my god!! i thought i was nuts but now i know i am only slightly mad. i
hear it too!!!!! i thought for sure that i was just hearing things but now
i know i am not alone. the truth is out there!!! i submitted that question
to the woman planning the interview of the girls: "what is being said by
amy's grandmother during ozilline?" i will try to ask them if i can in
orlando.
nancy
-----original message-----
from: sabrina d. parker [mailto:parkers@civerolo.com]
sent: wednesday, october 20, 1999 3:28 pm
to: indigo-girls@netspace.org
subject: ozilline
speaking of ozilline ... does anyone have any idea what the chorus/backing
vocals are saying during the song?
also, does anyone else hear amy's grandmother continue to speak during the
entire song? i can hear it on headphones, although i can't make out what
she's saying. i think it's fascinating.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:57:47 -0400
reply-to: havanamoon <missing_lynx@email.msn.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: havanamoon <missing_lynx@email.msn.com>
subject: re: jennifer jason leigh
haven't seen existenze, but my jennifer jason leigh collection includes
single white female, rush, bastard out of carolina (hugely disturbing
content), last exit to brooklyn, georgia, a thousand acres, and dolores
clairborne.
also loved mary stuart masterson as 'watts' in some kind of wonderful....
tim
-----original message-----
from: rick b sayre <scarybiker@cs.com>
to: indigo-girls@netspace.org <indigo-girls@netspace.org>
date: wednesday, october 20, 1999 1:27 pm
subject: re: [lesbian films]
>however (off-off topic)... has anyone seen existenz? i rented it last night
&
>was really surprised by it... i just expected it to be so-so, but it caught
>me off guard and left me with my jaw on the floor. not to mention my
>pseudo-crush on jennifer jason leigh.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:46:35 -0600
reply-to: justin shumaker <shuey@amarillonet.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: justin shumaker <shuey@amarillonet.com>
subject: re: jennifer jason leigh (nigc)
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
> haven't seen existenze, but my jennifer jason leigh collection includes
> single white female, rush, bastard out of carolina (hugely disturbing
> content), last exit to brooklyn, georgia, a thousand acres, and dolores
> clairborne.
let us not forget jennifer jason leigh in "the hudsucker proxy", my favorite
non-holiday movie.
"you know...for kids!"
--
_________________________________
justin shumaker
webmaster
amarillo globe-news online
---------------------->
http://amarillonet.com
shuey@amarillonet.com
(806) 345-3467 | (800) 692-4052
_________________________________
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:49:23 -0500
reply-to: sheryl jones <sljones1@facstaff.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sheryl jones <sljones1@facstaff.wisc.edu>
subject: review from atlanta constitution
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
the atlanta journal and constitution october 14, 1999, thursday, home edition
on music: indigos push envelope of folkie soul
by steve dollar, staff
rock "come on now social" indigo girls. epic. 12 tracks. grade: b
bathed in the nervous light of mtv and teased by the perverse transience of
instant stardom, the contemporary music consumer can't count on much. the
pop charts often appear to be the diabolical work of a top-secret cloning
lab, where backstreet boys can be endlessly minted and no one remembers
what songs sounded like without samples.
it's in this atmosphere that atlanta's indigo girls seem almost radical.
not because of their politics. expressed in song, these can be cloying even
when you agree with every fundamentally human right they passionately
espouse. but, simply, because vocalists and songwriters amy ray and emily
saliers do whatever they want, and do it by insisting on an enlightened
southern consciousness that is never at odds with the everlasting urge to
rowdy on down.
"come on now social," the duo's seventh studio album, picks up where 1997's
career-high "shaming of the sun" left off: with a sonic surprise. the
album's opener, "go," adds an urgent layer of clash-style combat rock to
the indigos' always strong harmonies. elsewhere across the cd's dozen
tracks, an all-star studio band (everyone from joan osborne to the band's
garth hudson drops by) continually complicates the songs, which bounce
between mellow romantic reveries (saliers' "peace tonight" and "we are
together") and more pointedly social concerns (ray's no-go-death-row ballad
for "faye tucker," which echoes the like-minded country protest of steve
earle). when the music really swings, it's because the indigos have struck
a perfect balance between the banjo and the beatbox. the album's
highlights, saliers' "trouble" and ray's "ozilline," do just that,
grounding belief in daily experience, finding the weight of the world in a
handful of red clay.
----------------------------------------------------------
sheryl jones
sljones1@facstaff.wisc.edu
cooper seay page: http://www.geocities.com/felidae/cooper/cooper.htm
bootleg page: http://www.geocities.com/felidae/boots.htm
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:55:55 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
subject: re: gay films (nigc)
mime-version: 1.0
content-type: text/plain; charset=us-ascii
--- elaine bean <bean@neu.edu> wrote:
> love, compassion and valour - george costanza from seinfeld was in
> it.
love! valour! compassion! was originally a tony award winning play by
terrence mcnally... and i thought the play was much much better than
the movie. in my opinion the movie overdid it a bit, erring on the
side of melodrama, not to mention added about half an hour to it. but
if you'll never get to see the play, the movie is the next best thing,
and there is some really good acting in it (although i personally
didn't care much for jason alexander's work).
my 2 cents ;)
jean
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:51:36 -0500
reply-to: sheryl jones <sljones1@facstaff.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sheryl jones <sljones1@facstaff.wisc.edu>
subject: review from indianapolis star
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
the indianapolis star
october 10, 1999 sunday city final edition
new music releases
indigo girls
"come on now social," epic records. reviewed by staff writer
diana penner.
3 stars
amy ray and emily saliers have a working rhythm down, but it's at
times a little predictable - one from emily, one from amy. amy's
more edgy, emily's more airy. the fabric of their music has become
as familiar as a family quilt; it's still comfy, but a little worn.
they have added some new partners on their seventh album for
epic, drawing on lilith fair buddies like joan osborne, me'shell
ndegeocello and sheryl crow. but they retain their earnest
folk-rock sound, emphasizing their dual harmonies.
ray, in particular, flexes her songwriting muscle, showing
versatility and range. she's a bit righteous with faye tucker, but
rocks on compromise; introduces us to her grandmother on the
poignant, country-tinged ozilline; and turns in an aw-shucks,
catchy folk song with gone again.
in all likelihood, it'll be emily's songs that get the most
airplay, notably the feel-good peace tonight with its irresistible
melody.
----------------------------------------------------------
sheryl jones
sljones1@facstaff.wisc.edu
cooper seay page: http://www.geocities.com/felidae/cooper/cooper.htm
bootleg page: http://www.geocities.com/felidae/boots.htm
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 11:12:06 -0700
reply-to: dawn manuel <venussage@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: dawn manuel <venussage@yahoo.com>
subject: dallas concert on 10/28
mime-version: 1.0
content-type: text/plain; charset=us-ascii
is anyone planning to boot the show? does anyone know
who is opening?
=====
dawn
"got to learn to respect what you don't understand" amy ray
"what i won't give, to have the things that mean the most, not to mean the things i miss." emily saliers
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:55:50 -0500
reply-to: sheryl jones <sljones1@facstaff.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sheryl jones <sljones1@facstaff.wisc.edu>
subject: concert review from boston globe
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
the boston herald
indigo girls play with 'fine' energy
by sarah rodman
if hearing your own lyrics sung back to you onstage feels as good as most
rock stars claim, then the indigo girls must be in a constant state of
nirvana.
wednesday night at low-ell's tsongas arena, the primarily female crowd of
5,000-plus raised their voices high and often in a warm, aural embrace of
the georgia duo
and their thoughtful songs of love, hope, fear and pain.
the well-paced, tautly executed 90-minute show satisfyingly covered amy ray
and emily saliers' decadelong musical partnership, including a sizable
chunk of their
superbly diverse new album, "come on now social."
armed only with acoustic guitars, the girls kicked off with their first hit
and most beloved anthem, "closer to fine," immediately igniting the mass
choir effect.
the tempo and energy took a precipitous jump with ray's revved-up rocker
"go," as their new four-piece backing band took to the stage, beefing up
their rootsy,
acoustic sound.
ray praised the london-based quartet, that also appears on and helped
conceive "come on now social," for "bringing freshness" to the girls' sound.
indeed, blair cunningham's ringing cymbals, caroline dale's resonant cello,
clare kenny's melodic bass lines and carol isaacs' lyrical accordion work
added heft to new
songs such as the breezy, southern "peace tonight," the dreamy ballad "soon
to be nothing" and the searing "faye tucker."
that last song, concerning the first execution of a woman, carla faye
tucker, in texas since 1871, rocked with a bite not normally associated
with the girls, a signature
of this show. the rhythms roiled with electric tension, the cello seesawed
an irish jig, the drums crashed in waves and ray barked out lyrics about
the fight over a
woman's life.
that energy fed into other songs including saliers' "trouble," ray's
appalachian jubilee "gone again" and older songs such as "land of canaan"
and "scooter boys."
as always, the duo's distinctive harmonies, with saliers' dusky soprano
cradling ray's raspy alto, soared on the acoustic ballads, especially the
romantic "power of
two."
graciously thanking the supportive crowd, the girls closed triumphantly
with a buoyant "galileo."
the consistently louder, harder-edged rock band the butchies opened to not
quite as much support
----------------------------------------------------------
sheryl jones
sljones1@facstaff.wisc.edu
cooper seay page: http://www.geocities.com/felidae/cooper/cooper.htm
bootleg page: http://www.geocities.com/felidae/boots.htm
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:44:11 edt
reply-to: poprckgrrl@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: poprock grrl <poprckgrrl@aol.com>
subject: dyke culture
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
<<<seriously though...what is dyke culture? bar-hopping and wife-swapping?
living with 4 or 5 other people because we are too poor to make it on our
own? (yes i know poverty is a huge problem in the dyke community, as it is
in the rest of our society)? alot of the movies out there would have us
believe we are lay in wait for the next str8 grrl to come along so we can
recruit her.>>>
you mean you're not trying to recruit every woman who comes within arms
length? ;)
damn it i want more toaster ovens!!!! :)
relax...i'm joking people!
wold someone please shut me up today!!!!!
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 16:05:05 -0500
reply-to: "jennifer k. parker" <jkp30@juno.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "jennifer k. parker" <jkp30@juno.com>
subject: nigc - lesbian films
mime-version: 1.0
content-type: text/plain
content-transfer-encoding: 7bit
i have tried and tried to explain the fact that being my being lesbian is
not all about sex to my mom, but somehow i am failing because she brought
it up again in front of my brother as recently as last week...as in "jen
says being a gay isn't only about sex" to which my brother responded "of
course it is!!!"
>>poprock grrl wrote: "last time i checked being a dyke wasn't all about
sex though..."
what can i say to them to let them (and others) better understand what i
mean when i say that?! i am obviously not saying the right thing. so
when i saw that poprock grrl wrote that i was like "see!!!!!" *grin*
anyway, maybe one of you can help.
thanks in advance.
jennifer
*counting down the hours til ig in dallas...have i mentioned i have 8th
row emily side seats??? wheeeeeeee!!!!!!!!!! *
___________________________________________________________________
get the internet just the way you want it.
free software, free e-mail, and free internet access for a month!
try juno web: http://dl.www.juno.com/dynoget/tagj.
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 11:41:01 -0700
reply-to: first last <eveseve@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: first last <eveseve@yahoo.com>
subject: re: age poll update
mime-version: 1.0
content-type: text/plain; charset=us-ascii
i think we mean sex and not gender. it may seem a
small point, but sex refers to the biological
male/female question whereas gender calls in terms
like masculine/feminine (though it is ofttimes misused
interchangably with sex, thereby reaffirming
traditional stereotypes that a male should be
masculine and a woman feminine).
*eve
> just a reminder...we are asking for age, gender and
> years listening to the
> girls. i have had a request or two for sexual pref.
> but it is kinda too late
> in the game to add that...(sorry to those that
> requested).
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 21:18:15 +0000
reply-to: kz123@att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristen curry <kz123@att.net>
subject: re: movies (nigc) and folk (igc)
my personal preference would be to see this thread
continue on the mailing list. it's been well marked as
nigc and has brought a lot of folks out of the woodwork.
plus that it's just been fun to read.
my .02
kc
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:46:52 -0400
reply-to: bean@neu.edu
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: elaine bean <bean@neu.edu>
organization: northeastern university, faculty senate office, 442 ry,
360 huntington ave., boston, ma 02115
subject: re: online film source and the most disturbing movie ever nigc
x-to: scarybiker@cs.com
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
rick wrote:
> clockwork orange is one of 2 films i could just not watch entirely. the other
> was an awful movie called strangeland
also, "caligula" was a horribly graphically violent, vile, film. it's
depiction of random cruelty and callous murder turned my stomach.(it
really made me physically ill) - not to mention the dispicable (sp?) and
humiliating rape scenes.
elaine
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 17:31:15 -0400
reply-to: "i am 32 flavors and then some..." <tisara@www.webworqs.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "i am 32 flavors and then some..." <tisara@www.webworqs.com>
subject: lesbian books/authors
mime-version: 1.0
content-type: text/plain; charset=us-ascii
yay! more good stuff. i love alison bechdel but i wouldn't doubt she is
expensive...we just had carolyn gage at our lgbt conference yesterday -
she was fabulous! she did her one act, one woman play "the second coming
of joan of arc"...i don't know what your price range is for speakers, but
i think carolyn was a couple thousand (i can get a more accurate number if
you want)...and i also have carolyn's email address so if you want me to
pass on a request for you, i would be willing...and anyone else for that
matter. just email me privately...
--audra
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
=<www.geocities.com/westhollywood/2670>=*=<www.angelfire.com/pa/tisara/>=
"you said 'i love you.' why is it that the most unoriginal thing we can
say to one another is still the thing we long to hear?"
--jeanette winterson, "written on the body" (p.9)
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 14:36:37 -0700
reply-to: dawn manuel <venussage@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: dawn manuel <venussage@yahoo.com>
subject: dallas concert
mime-version: 1.0
content-type: text/plain; charset=us-ascii
is anyone planning to boot the show in dallas on
october 28? also, does anyone know who is opening?
=====
dawn
"got to learn to respect what you don't understand" amy ray
"what i won't give, to have the things that mean the most, not to mean the things i miss." emily saliers
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 19:10:30 +0100
reply-to: john bond <john.bond@lineone.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: john bond <john.bond@lineone.net>
subject: re: lebian film
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
ooooh - films, books and ig : my three fav. subjects combined......
well, books i'd guess i'd have to say anything by jeanette winterson (i
loved sexing the cherry : some great imagery in there....) and the "tales of
the city" series by armistead maupin : i had my first gay crush on mouse :)
: he was just so cute....
and of course, patricia cornwell : lucy is just one of my favourite
characters of all time....
john.
erica weinstein wrote:
> maybe we could discuss lesbian books too. i am trying to get alison
> bechdel, the author of dykes to watch out for, to speak at dyke days but
> i think she is way too expensive. she sent me a personal e-mail about
> it *sigh* and i am going to have to turn her down. i am so
> disappointed.
--
"every sperm is sacred,
every sperm is great.
if a sperm is wasted,
god gets quite irate..."
(monty python - the meaning of life)
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 17:42:35 -0400
reply-to: kelly <khager@shore.intercom.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kelly <khager@shore.intercom.net>
subject: re: lesbian books/authors
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
if you like mysteries, i'd recommend sandra scoppettone. her character
lauren laurano is a p.i. who lives in greenwich village with her partner,
kip. very cool. :)
i forget who said that they had a crush on kay scarpetta's niece, lucy, but
i would convert for lauren. so don't feel bad. :)
kelly
"it's too corny to cry." amy ray; "joking."
"i missed ten million miles of road i should have seen." emily saliers;
"love's recovery."
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 17:43:25 edt
reply-to: lisa071573@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lisa r <lisa071573@aol.com>
subject: nigc - smashing little shindig, movies, breakdown ...
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i hope all you ny-ers are going to this smashing shinding in nyc - i can
vouch for barbara (obviously) she's terrific!!! back to movies - yeah, i also
hated the violence factor in bound, which is probably why i'll never rent it
again....i remember the episode of relativity with the eartquake simulator -
very sexy! wish i had taped that one....my so-called life was a better show
than relativity but oh well...they both got cancelled. i liked high art up
until the last five minutes...i don't like how everyone has to end up
dead...foxfire was wonderful - and yeah, legs never should have left town by
herself. a clockwork orange was definitely the most disturbing movie i have
ever seen - we watched it in a film class and i walked out half way thru. i
sat thru the whole thing for another film class but yuk, never again. the
book was even worse and more violent.
on another non-ig topic...did anyone buy melissa's "breakdown" - i bought the
ltd edition version with the extra tracks but there are no lyrics included (a
book but no lyrics) i was just wondering if anyone had bought the standard
edition and if it came with lyrics...i'll never understand why people don't
include lyrics...
lisa
"at my age i should know better, i should have a winter coat." barbara kessler
<<
------------------------------
date: wed, 20 oct 1999 00:14:27 edt
from: jilly c <jillyc@hotmail.com>
subject: nigc. smashing little shindig in nyc thursday
heya. anybody interested in going to this? i think i'll be there, if that,
uh, sweetens the deal or anything. (ha.)
laurie geltman sounds like etheridge
and pamela means is cool as a slurpee.
i'm not in the know about the other two, but hey, take a chance.
come play?
jill
>thursday, october 21 @ 8pm
>best of boston songwriters presented by bmi
>the living room
>corner of stanton & allen
>nyc, ny
>212-533-7235
>line-up: laurie geltman, barbara kessler, nate borofsky, pamela means. >>
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:07:32 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: nigc - gay films
mime-version: 1.0
content-type: text/plain; charset=us-ascii
--- elaine bean <bean@neu.edu> wrote:
> love, compassion and valour - george costanza from seinfeld was in
> it.
love! valour! compassion! was originally a tony award winning play by
terrence mcnally... and i thought the play was much much better than
the movie. in my opinion the movie overdid it a bit, erring on the
side of melodrama, not to mention added about half an hour to it. but
if you'll never get to see the play, the movie is the next best thing,
and there is some really good acting in it (although i personally
didn't care much for jason alexander's work).
and in response to moving this to email, i am thoroughly enjoying this
thread, not to mention adding some movies to my list of things to see.
i personally would like to see it stay on the list. i'm really
enjoying all the differing opinions, and am learning something about
the different personalities on the list too... no better way to learn
about people than to find out what they do and don't enjoy
artistically. it's a fun/friendly way to get to know people.
jean
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 15:37:34 -0700
reply-to: "amy j. putnam" <pegasus@crl.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "amy j. putnam" <pegasus@crl.com>
subject: re: age poll update
x-to: first last <eveseve@yahoo.com>
in-reply-to: <19991020184101.29649.rocketmail@web1403.mail.yahoo.com>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
but, to get nitpicky, there are those whose physical sex may not
truly reflect their gender. as you say, they are separate things.
but not all male sexed beings will consider themselves "men",
and not all female sexed beings consider themselves to be "women".
by trying to define me by physical sex, you are not getting any
true reflection of my gender or gender expression. gender gives
more people room to use whatever words they feel best expresses
themselves in that manner (and yes, for many that will be male/man
or female/woman. but not for all...)
on wed, 20 oct 1999, first last wrote:
> i think we mean sex and not gender. it may seem a
> small point, but sex refers to the biological
> male/female question whereas gender calls in terms
> like masculine/feminine (though it is ofttimes misused
> interchangably with sex, thereby reaffirming
> traditional stereotypes that a male should be
> masculine and a woman feminine).
>
> *eve
>
>
> > just a reminder...we are asking for age, gender and
> > years listening to the
> > girls. i have had a request or two for sexual pref.
> > but it is kinda too late
> > in the game to add that...(sorry to those that
> > requested).
> __________________________________________________
> do you yahoo!?
> bid and sell for free at http://auctions.yahoo.com
>
> --
> all listserv commands should be sent to listserv@netspace.org.
> to unsubscribe issue the command: signoff indigo-girls
> for help write to indigo-girls-request@netspace.org.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
_________
amy p. \ / who holds your hand
pegasus@crl.com \ / when you're alone
monk@world.std.com \ /
the original photo monk \ / --patty larkin
http://www.crl.com/~pegasus
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 19:29:55 edt
reply-to: scarybiker@cs.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: rick b sayre <scarybiker@cs.com>
subject: re: gay films (nigc)
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 10/20/99 4:34:33 pm eastern daylight time, bean@neu.edu
writes:
> jeffrey - captain picard? from star trek was in this. so was one of
> the brothers from that show "wings"
yeah yeah yeah... let's discuss michael t. weiss of the pretender :) oooh
baby. um, miss dupre, can i get an amen?
anyway- i'm really enjoying this thread a lot. so i don't know... i felt
inspired and decided to start up a community on onelist for gay & lesbian
films. so if you're interested or anyone else is, go to www.onelist.com and
look up glmovies. and if you know of anybody who might wanna join the list
let 'em know!! i figured maybe that way those of us who are as into this
thread as i am will have another outlet instead of flooding the list with the
nigc.
just an idea. :)
peace,
rick
who of course has now amassed a list of films to rent & will be checking out
bent this very evening. (along with metroland, that is)
*i guess it comes apart so little by little
you don't know you're there till you're stuck in the middle* -emily saliers
<a href="http://members.aol.com/rbsayre/cheese.html">sweet page o'mine</a>
*there ain't no way i'm gonna let this heart mend* -amy ray
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 13:59:14 -0400
reply-to: michael cunningham <mcunningham@pbp1.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: michael cunningham <mcunningham@pbp1.com>
subject: onsale info?
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
dear rec.movies.lesbian,
;-)
i'm trying to unravel the many onsale mysteries that are out there right now
for the saliers & ray mystery bus. i cut & pasted all of the shows that
don't have any onsale information in the hopes that some of y'all might have
some insight to these. this is an incomplete list! please see my site for
the complete tour dates:
http://home.earthlink.net/~mcunningham5/indigotour.html
11/03/99 los angeles, ca wiltern theatre ?
11/18/99 laramie, wy arts & science aud. ?
11/20/99 denver, co fillmore auditorium ?
12/01/99 saint louis, mo fox theatre ?
12/02/99 omaha, ne omaha civic auditorium - music hall ?
12/03/99 eau claire, wi univ. of wisconsin ?
12/04/99 minneapolis, mn northrup auditorium ?
12/07/99 indianapolis, in murat theatre ?
12/09/99 bloomington, in indiana univ. - auditorium ?
12/10/99 ann arbor, mi university of michigan - ann arbor ?
12/11/99 columbus, oh columbus civic center ?
12/12/99 fort wayne, in embassy theatre ?
12/14/99 louisville, ky palace theatre ?
12/16/99 atlanta, ga the tabernacle ?
12/17/99 atlanta, ga the tabernacle ?
thanks for any info to help us out!!!
a+e=ig
mcunningham5@earthlink.net
http://home.earthlink.net/~mcunningham5/indigotour.html
"...what a blessed sky"
--
all listserv commands should be sent to listserv@netspace.org.
to unsubscribe issue the command: signoff indigo-girls
for help write to indigo-girls-request@netspace.org.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 17:30:54 pdt
reply-to: lia kueck <aeig2317@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lia kueck <aeig2317@hotmail.com>
subject: the midwest conspiracy
mime-version: 1.0
content-type: text/plain; format=flowed
hello everyone,
i've done a little research, and here's what i've come up with.
1. chicago 12-5 chicago theater 175 n state street show starts at 8pm.
tickets onsale this saturday at noon through
ticketcrapper/bastard/master...whichever you prefer.
2. indianapolis 12-7 murat theater 510 n new jersey st. ???
ok, here's where the story gets a bit interesting...on the official site
this date and venue is listed...but the link and the phone number are bogus.
i looked up this place on the internet and found the real phone number, but
when i called the lady was really pissed off and said, "we don't know
anything about tickets to this 'indigo girls' concert (she said it really
snooty) you people need to quit calling!" so i naturally started cracking
up....and then she hung up on me. oops. i just pictured her phone ringing
off the hook with people bombarding her with questions about the indigo
girls and when tickets were going on sale....ha! i'm still laughing...
aaaanyway....move on, lia
3. milwaukee 12-8 riverside theater 116 wisconsin ave
tickets go on sale monday oct 25th (414) 224-3000
can anyone else confirm this and let us know what time??
4. bloomington 12-9 indiana university auditorium
ok, i've got a friend at iu who's checking on this one for me...he also let
me know that iu is notorious for cancelling concerts this year...but i'm not
giving up hope. the phone number is (812)855-1103. they said they have no
confirmation of the show yet...so who knows. you can find a map of the
seating at http://iuauditorium.indiana.edu/images/orch.gif or just go to
iuauditorium.com
5. 12-10 i'm not touching this one....there's a show...somewhere in
michigan...ann arbor? eastern michigan university? anyone? what's going on?
6. columbus 12-11 once again, no clue
7. fort wayne 12-12 embassy theater (219)424-5665-i haven't gotten through
to this one yet during office hours...but it sounds legit.
8. dayton???
well, folks, there you have it...8 beautiful promising shows in the midwest,
and only two confirmations so far...someone must have been a little out of
it when they were typing the info in the links from the epic site because i
only got about 2 right numbers i think...oh well...the mysteries continue.
is anyone else as confused as i am, or am i just stressing too much?
keepin it real,
lia
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 20:53:17 edt
reply-to: jenindgo@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jennifer belton <jenindgo@aol.com>
subject: still tix available for 11/7 berkeley & listmeet
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
fyi: there are still tickets available for the nov. 7th show in berkeley
for all interested. as for openers, it says rose polenzani is opening for
the show on 11-6 and vonda sheppard opens on 11/7! can't wait!!
also, we are planning a listmeet for at least the 11-6 show, if there's
enough people going to the 11/7 show, we'll have one for that too. if you're
interested in a listmeet please e-mail me off the list......jenindgo@aol.com
hope to meet a lot of you there! jennifer
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 21:22:47 -0400
reply-to: andi lipman <ablipman@sas.upenn.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: andi lipman <ablipman@sas.upenn.edu>
subject: queer movies/philosophy of loss
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
for those who said that "bound" was written & directed by men, & therefore
doesn't reflect dykes well, read susie bright's story about being the sex
consultant for the movie: http://www.susiebright.com/books/bound.html
the closest movie i've seen to a male version of "2 girls in love" is "get
real," a british coming of age flick. i loved it! check out the webpage
here: http://www.paramountclassics.com/getreal/index.html.
and for some igc, does anyone know if emily is playing piano on philosophy
of loss on the cd? when she played it live, did she play keyboards? i'm
just curious about whether she's written any songs on piano since leeds &
winthrop.
andi
_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_--_-_-_-_-_-_-_
andrea lipman
e-mail: ablipman@sas.upenn.edu
homepage: http://www.sas.upenn.edu/~ablipman
"and all i want is nothing to do
'cause it's a long walk to the bus stop
it's a long wait for the turning clock"-emily saliers
_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_--_-_-_-_-_-_-_-
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 21:26:58 edt
reply-to: wishmonstr@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "e. moranian bolles" <wishmonstr@aol.com>
subject: re: [lesbian films]
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
scarybiker@cs.com writes:
<< and also thought i'd mention alfred hitchcock's rope... which is a dark,
dark
comedy that centers around a couple of gay men. movies such as this are never
made today *sigh* >>
another older movie (probably older than rope) is the great saint louis bank
robbery. a very early steve mcqueen flick. a true story. it revolves
around the homosexual affair of these two bank robbers, and how the
bitterness they feel towards society as result of their disenfranchisement
drives them to resent their oppressors. perhaps it was just about some gay
guys and a bank robbery. *shrug* another film with a gay bank robber as the
protagonist is... ack, what's it called? al pacino and that guy who died...?
it's set in brooklyn, on a hot day, in the 1970s? you know the one. :)
a beautiful thing is likely my favorite gay movie.
the bad acting in go fish bothered me tremendously. plus, i really hated 2
girls in love. the script was embarassingly bad! i watched it with two
other girls... we all sat there making fun of the script the entire time. it
did pick up towards the end, though.
*sigh*
remind me never to apply to college again, by the way. this whole essay
thing is driving me crazy.
~ elizabeth
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 21:31:28 edt
reply-to: wishmonstr@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "e. moranian bolles" <wishmonstr@aol.com>
subject: re: online film source and the most disturbing movie ever nigc
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
<<and, of course "clockwork orange" heads the list for all time unsettling
movie. >>
clockwork orange was the feel good movie of the century, as far as i'm
concerned! well, maybe not so much... but it did leave me feeling very warm
and fuzzy and empowered. it was kind of an anti-1984, which we had just read
in english when i saw clockwork, so maybe that affected things. but, god,
kubrick was a genius!
does this suggest i have problems? i hope not.
=d
~ elizabeth
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 21:37:03 -0400
reply-to: elaine bean <efbean@erols.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: elaine bean <efbean@erols.com>
subject: re: [lesbian films]
x-to: wishmonstr@aol.com
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
e. moranian bolles wrote:
> around the homosexual affair of these two bank robbers, and how the
> bitterness they feel towards society as result of their disenfranchisement
> drives them to resent their oppressors. perhaps it was just about some gay
> guys and a bank robbery. *shrug* another film with a gay bank robber as the
> protagonist is... ack, what's it called? al pacino and that guy who died...?
> it's set in brooklyn, on a hot day, in the 1970s? you know the one.
i forgot about this one! "dog day afternoon" - funny, sad, poignant,
pathetic. i seem to recall that this was a true story and that they
robbed the bank so they could pay for a sex change operation for al's
lover and co-robber. i don't know how much is true and how much is
"hollywood-ized".
elaine
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 21:57:40 edt
reply-to: dldmsd@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: derek duncan <dldmsd@aol.com>
subject: re: bootlegs (tara rules!!!!!)
x-to: telane@trigon.com
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
wow!... i just received my copy of 9:30 club cds. probably the best artwork
i have ever seen on a boot (includind ones i purchased). sound quality is
excellent as well.
thanks again tara, i look forward to your future offerings. i see that you
do not list history of us. this boot actually contains r1l, but also
includes a set of ig opening for the dead.
--derek
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 22:17:19 edt
reply-to: wishmonstr@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "e. moranian bolles" <wishmonstr@aol.com>
subject: re: online film source and the most disturbing movie ever nigc
x-to: efbean@erols.com
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
efbean@erols.com writes:
<< i don't know how much the book and the film version differ, but i saw
the film. the film depicted lots and lots of bad stuff - maybe the book
didn't. i don't know, but if you "feel good" and "warm and fuzzy"
about violent rape and murder and horrendous cruelty . . .
but violent rape and murder is the stuff that makes you feel
empowered? i think you're saying outrageous things to get some kind of
reaction from people on the list, aren't you? >>
perhaps i should clarify....
alright, i definitely don't find rape, murder, or horrendous cruelty
empowering or warm and fuzzy! what i did find empowering, and what did leave
me feeling good about things, was the main point of the movie, not so much
the behavior contained within. 1984 is all about how "they can break you if
they want to" and that people don't actually have supreme control over their
minds, etc. but a clockwork orange is about how if you're strong enough and
have the will power, they'll never win -- or, as ulrich zwingli (the
reformation? anyone? buller? anyone?) said as he fell to his death on the
battlefield, "you can kill the body but not the soul!" i personally found it
a very empowering theme, even if the delivery involved a woman being murdered
with a penis statue. ;) if that makes me disturbed, well.... then there you
go.
"it was old ludwig van...."
kubrick's genius lies in part in the fact there's all this disturbing stuff
going on, but it's empowering at the same time. especially having just read
1984. dood...
~ elizabeth
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 22:34:40 edt
reply-to: lyndsay agans <eccemus@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lyndsay agans <eccemus@hotmail.com>
subject: ig window clings--for your car, windows...whatever!
mime-version: 1.0
content-type: text/plain; format=flowed
hey y'all...
ok, so i was on ebay before and i saw window clings up for sale and someone
was paying an extremely high price for one. now, i've decided to offer to
this list some that i've made. these are full color, quality clings which
you can put on your car, on your window, whatever...to keep costs down i
didn't treat them, so they're only for indoor use. okay, here are the design
descriptions:
1)i'm listening to the
indigo girls
2) melbourne wrecking crew
3) a+e=ig
4) indigo girls (in rainbow color, hehe)
5) i "love" amy & emily
(the love will be a red heart)
i'm working on a t-shirt with the melbourne wrecking crew design with
"courting some disaster" on the back which may be available depending on
demand. and also one with a funky peace/moon graphic that on the front says
indigo girls and on the back says "let's make peace tonight in a good time."
(please keep in mind the window clings are not just plain text, but very
vibrant and pleasing graphics :)
okay, so here's the deal: 3 bucks for one or 2 for $5. sorry, it costs
something to make 'em. it would also cost you a self addressed stamped
envelope. (do not forget the sase)
send responses privately back to me-we'll go from there.
peace tonight,
lyndsay
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 22:43:29 edt
reply-to: erinsuepoo@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "<erin carroll>" <erinsuepoo@aol.com>
subject: re: age poll update
x-to: eveseve@yahoo.com
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
sorry if i (or anyone else using the word gender) offended anyone. thanks
for *enlightening* us. we are looking for age, sex and number of years
listening. i certainly didn't mean to offend anyone....
erin sue
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 22:50:52 edt
reply-to: lyndsay agans <eccemus@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lyndsay agans <eccemus@hotmail.com>
subject: cons--title from amy...discussion...
mime-version: 1.0
content-type: text/plain; format=flowed
okay, so in an attempt to get off this movie thing. (where i have to say,
boys on the side {in which the girls make a cameo}) is fab.
anyway...i've been listening and listening to come on now social...and from
the start i thought, wait isn't this from the boys just laugh? (don't know
exact title)indeed it is. a) why is this song not one of the hidden tracks?
b) see a, i 'cause i forgot my second point...(oh, wait or why isn't it just
a regular track??)hmph.
allright, for your literary pleasure-the lyrics:
the boy, he thinks i'm damaged goods
i guess he does and i knew he would
i dress like him and i'll take him down
he gets embarrassed when his friends come around
i can get the girl, but the boy just laughs
i can get the girl, but the boy just laughs
guess all this is a measure of me
even though it shouldn't be
the lion lays down with the lamb
but i can't do it so i ain't worth a damn
i can get the girls, but the boys just laugh
i can get the girls, but the boys just laugh at me>
come on now angel, i said i want you to be
come on now special, i said i want you to be
*come on now social, you know i want you to be
you know i want you...
am i the virgin in your woods?
are you all that's strong and all that's good?
i'll be the needle for your skin.
ask me now and i will push it in.
i can - get the girls, but the boys just laugh
i can get the girls but the boys just laugh at me
i can get the girls, oh but the boys just laugh
you know this is a measure of me
and even though it shouldn't be
the lion lays down with the lamb
but i can't do it, so i ain't worth a damn...
it was damn moving live...amazing. so, who knows, anyone have answer for
this one? maybe i should just ask amy next time we do lunch...haha!
ogidni,
lyndsay
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 22:49:12 -0400
reply-to: nancy golumbia <nancyg2@sas.upenn.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: nancy golumbia <nancyg2@sas.upenn.edu>
subject: mp3's
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
hkf,
just to let you know that it seems not one of us listees has been
recently able to find any indigo girls mp3's. all i can say is, let's
keep looking, and please let's all let everyone know if we find
something, although i suspect we may already be too late :(
peace tonight,
nancy
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 22:50:21 edt
reply-to: memememi@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: memememi@aol.com
subject: upcoming ig appearance in san francisco
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
a heads up to all the people in the san francisco area:
indigo girls will be making an instore appearance at a tower records in the
san francisco area on sunday, november 7th. it is unknown whether it will
be a signing, or a performance as of yet. this is all that has been
confirmed as of right now. when i find out which tower records (there are 23
in the sf area), i will let everyone know asap.
now, this is *very* important:
******please do not call the stores, as no more details have been decided
yet.*******
the stores know nothing of this yet. you will confuse them, and get them
upset. i was just asked to pass this preliminary info on, so people can be
aware of it, before they make their plans for the weekend.
again, please do not call the stores to try and find out more info. i will
be informed as soon as the details have been settled, and i will let the list
know as soon as i can.
thanks!
=)
lisa
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 22:50:16 edt
reply-to: memememi@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: memememi@aol.com
subject: nigc: atlanta music goes to boston!
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
hi everyone,
atlanta music takes a road trip this weekend!
some really great atlanta musicians are heading to boston this weekend to
participate in "queerstock", a showcase of the best music from openly
gay/lesbian/bisexual/transgender musicians. this event was originally put
together by doria roberts in atlanta, and has always gotten great reviews.
some other musicians that have participated in the past include sonia (of
disappear fear), and melissa ferrick. this year, queerstock is branching
out and going to boston and new york!
the event in boston runs from thursday, october 21st through saturday,
october 23rd. the atlanta musicians heading up north for the shows are
cooper seay, commonwealth, doria roberts, and angela motter.
here's the details, in case you are in the area, and would like to check it
out.
when: thursday, october 21st
time: 8:00 pm
where: the midway cafe, 3496 washington st. jamaica plain
artists: angela motter, the steph pappas experience, mehuman jonson,
and surprises
when: friday, october 22nd
time: 8:00 pm
where: allston area - call for reservations & information: (617)783-8244
artists: commonwealth, pamela means, gardenverge & surprises
when: saturday, october 23rd
time: 12:00 noon to 5:00 pm all day (note - this is during the day on
saturday)
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
where: the milky way lounge & lanes, 403-405 centre street, jamaica plain
artists: cooper seay, doria roberts, rick berlin, tara lynne, cd
collins and pincurl, robert urban,
jessie zoldak and band, letta neely, and surprises
for more info on any of the atlanta artists, check out their websites:
cooper seay (http://girlsrock.net/cooper) (note: this is a new website
address for her)
commonwealth (http://www.monsterbit.com/commonwealth)
angela motter (http://www.angelamotter.com)
doria roberts (http://www.geocities.com/sunsetstrip/diner/1752/lilith.html )
for information on queerstock, call 617-983-8884 or go to
http://www.hanarchy.com. it's going to be a great weekend. i'm going to be
up there myself, so hopefully i'll see some of my wonderful newport friends
(bren! sarah! laura! sus!)
=)
lisa
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 22:03:00 -0500
reply-to: lisa <brewgirl@pinenet.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lisa <brewgirl@pinenet.com>
subject: re: boys dont cry
x-to: poprckgrrl@aol.com
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
>
>it's opening friday nationwide int eh top 20 markets...not sure what they
>consider the top 20 markets though...
minneapolis is one of them. sneak preview was tonight. didn't see it yet,
but plan on it this weekend.
lisa
brewgirl
"i won't forget when peter pan came to my home, took my hand
i said i was a boy, i'm glad he didn't check."
-dar williams
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 23:24:32 -0400
reply-to: mark anthony donajkowski <madonajk@alpha.delta.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: mark anthony donajkowski <madonajk@alpha.delta.edu>
subject: re: nigc - lesbian films
x-to: "jennifer k. parker" <jkp30@juno.com>
in-reply-to: <19991020.160509.-929161.2.jkp30@juno.com>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
tell her you being lesbian is about sex as much as her being straight is
about sex
on wed, 20 oct 1999, jennifer k. parker wrote:
> i have tried and tried to explain the fact that being my being lesbian is
> not all about sex to my mom, but somehow i am failing because she brought
> it up again in front of my brother as recently as last week...as in "jen
> says being a gay isn't only about sex" to which my brother responded "of
> course it is!!!"
>
>
> >>poprock grrl wrote: "last time i checked being a dyke wasn't all about
> sex though..."
>
> what can i say to them to let them (and others) better understand what i
> mean when i say that?! i am obviously not saying the right thing. so
> when i saw that poprock grrl wrote that i was like "see!!!!!" *grin*
>
> anyway, maybe one of you can help.
>
> thanks in advance.
>
> jennifer
> *counting down the hours til ig in dallas...have i mentioned i have 8th
> row emily side seats??? wheeeeeeee!!!!!!!!!! *
>
>
> ___________________________________________________________________
> get the internet just the way you want it.
> free software, free e-mail, and free internet access for a month!
> try juno web: http://dl.www.juno.com/dynoget/tagj.
>
> --
> all listserv commands should be sent to listserv@netspace.org.
> to unsubscribe issue the command: signoff indigo-girls
> for help write to indigo-girls-request@netspace.org.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 20:39:40 pdt
reply-to: sexymotherfucker@ferdinand.diaryland.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: taylor martin <babybutch88@hotmail.com>
subject: re: mp3's
mime-version: 1.0
content-type: text/plain; format=flowed
www.audiofind.com has mystery on mp3. just do a search for indigo girls on
the first page.
www.scour .net has: least complicated, closer to fine, the water is wide
(w/ sarah & jewel), scooter boys, power of two, galileo (live and studio
versions), shame on you, romeo & juliet, and ghost. if you do a search for
indigo girls this is pretty much what you get plus about 6 pages of burp
sounds from a burp contest. very strange indeed.
also, http://members.aol.com/sighxx/indigo.html has touch me fall, mystery,
and fugitive (go visit some of the other artists here as well, very
impressive collection of mp3s including bjork, dave matthews, ani, tracy
chapman, tori, steve miller band, fleetwood mac, etc)
that's what i've found in my 10 minutes of searching. hope that helps.
~tay
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 23:15:09 -0500
reply-to: "margaret a. clayton" <maclayto@alumnae.mtholyoke.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "margaret a. clayton" <maclayto@alumnae.mtholyoke.edu>
subject: nigc: anyone from lagrange, ga (or close by)?
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
some random guy emailed me asking what the glb community is like in the
lagrange, ga, area. i'm originally from atlanta but haven't lived there in
over a decade. is there anyone who can help him? if you send your
thoughts to me i'll forward them along. thanks!
best,
margaret
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 00:19:15 -0400
reply-to: hicktruckdriver <dcw2428@osfmail.isc.rit.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: hicktruckdriver <dcw2428@osfmail.isc.rit.edu>
subject: re: nigc - lesbian films
x-to: mark anthony donajkowski <madonajk@alpha.delta.edu>
in-reply-to: <pine.osf.3.95.991020232408.31064f-100000@alpha.delta.edu>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
on wed, 20 oct 1999, mark anthony donajkowski wrote:
> tell her you being lesbian is about sex as much as her being straight is
> about sex
now that couldn't be taken either way. :)
darius
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 00:22:02 -0400
reply-to: mark anthony donajkowski <madonajk@alpha.delta.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: mark anthony donajkowski <madonajk@alpha.delta.edu>
subject: re: nigc - lesbian films
x-to: hicktruckdriver <dcw2428@osfmail.isc.rit.edu>
in-reply-to: <pine.osf.4.05.9910210018320.27694-100000@grace>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
heh yeah but it just may work
course im just a straigth man what do i know lol
on thu, 21 oct 1999, hicktruckdriver wrote:
> on wed, 20 oct 1999, mark anthony donajkowski wrote:
>
> > tell her you being lesbian is about sex as much as her being straight is
> > about sex
>
> now that couldn't be taken either way. :)
>
> darius
>
>
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 00:25:29 edt
reply-to: jenindgo@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jennifer belton <jenindgo@aol.com>
subject: if you're still in search of berkeley tix
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
if you're interested in seeing the girls in berkeley still, check this
site out
http://www.kfog.com/tixswap/index.html
this is a lcoal station here in the bay area and i've seen a couple of
posts for available tix for the upcoming shows. so if you're looking, check
it out.
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 00:32:14 edt
reply-to: sass60876@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: mandy clements <sass60876@aol.com>
subject: ig in dallas!!!
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
hey anybody goin to the concert in dallas on the 28th??? i'm headin up there
by my lonesome and i was just wonderin if anybody was going!? i got 2nd row
yeeeehhhaawwww! well y'all take it easy ya hear!
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 22:33:11 -0700
reply-to: hawke2@email.msn.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: ryan blackhawke <hawke2@email.msn.com>
subject: sex (nigc)
in-reply-to: <0.5ac846f3.253fd7d1@aol.com>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
you are looking for sex? well, there are numerous sites on the internet
where you can find sex...
:-^
> -----original message-----
> from: indigo girls mailing list [mailto:indigo-girls@netspace.org]on
> behalf of <erin carroll>
> sent: wednesday, october 20, 1999 7:43 pm
> to: indigo-girls@netspace.org
> subject: re: age poll update
>
>
> sorry if i (or anyone else using the word gender) offended anyone. thanks
> for *enlightening* us. we are looking for age, sex and number of years
> listening. i certainly didn't mean to offend anyone....
>
> erin sue
>
> --
> please do not send long non-indigo girls-related forwards to the list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: wed, 20 oct 1999 23:40:52 -0600
reply-to: kz123@worldnet.att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kz123@worldnet.att.net
subject: re: ig in dallas!!!
x-to: sass60876@aol.com
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
hey mandy!
i got second row, too. at least i think so. row b. i'm hoping that means second
row...
and yeah, there's a list meet being organized. there have been a couple
announcements - hopefully there will be one before i head for texas on the 25th
so i know who i'm looking for and where :-)
cheers,
kc
mandy clements wrote:
> hey anybody goin to the concert in dallas on the 28th??? i'm headin up there
> by my lonesome and i was just wonderin if anybody was going!? i got 2nd row
> yeeeehhhaawwww! well y'all take it easy ya hear!
>
> --
> please do not send long non-indigo girls-related forwards to the list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 02:55:03 edt
reply-to: cojehali@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "<connie lindell>" <cojehali@aol.com>
subject: nigc - gay films
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
hi y'all!
first, a quick intro...this is my first post to this list in quite some
time....i was on the list for a few years beginning in '95 but had to skip
out for a while due to time constraints....however, i recently came back to
hear the dialogue about the new cd and have been thoroughly enjoying my
return.. :)
<<and in response to moving this to email, i am thoroughly enjoying this
thread, not to mention adding some movies to my list of things to see.>>
just wanted to throw in my $.02 and say that i, too, have really been
enjoying this thread...i have recently returned to college and am currently
taking a wonderful cultural diversity/lifestyles class and one of the topics
is gay & lesbian issues - and one of our assignments is to watch some films
on the topic. love, valour, compassion is on the assigned list as is chasing
amy, object of my affections and priest (which i've already seen and thought
was excellent). so i've been taking notes and plan to pass on some of your
suggestions to the teacher for other possible film-watching assignments that
might benefit the class!
i've always found this list to be a great resource for both ig and other
thought-provoking topics (thought-provoking topics being one of the main
reasons i love ig so much!) and i'm glad to see it's still going strong on
both accounts! :)
-connie
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 00:00:30 -0700
reply-to: melissa gordon <melissa@ce1.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: melissa gordon <melissa@ce1.com>
organization: creative endeavors
subject: re: nigc: atlanta music goes to boston!
x-to: memememi@aol.com
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
dear all:
i wish i were a bostonian!
i had the pleasure of listening to doria roberts when she played for a group
i was involved with (national lesbian & gay journalists assn) in september.
not only was she a truly wonderful & inspired musician, but a terrific
person as well. she was battling some type of flu and still performed her
heart out.
she has a wonderful album, "restoration" & is a great artist live. pls try
to go out & support her.
melissa
----- original message -----
from: <memememi@aol.com>
to: <indigo-girls@netspace.org>
sent: wednesday, october 20, 1999 7:50 pm
subject: nigc: atlanta music goes to boston!
> hi everyone,
>
> atlanta music takes a road trip this weekend!
>
> some really great atlanta musicians are heading to boston this weekend to
> participate in "queerstock", a showcase of the best music from openly
> gay/lesbian/bisexual/transgender musicians. this event was originally
put
> together by doria roberts in atlanta, and has always gotten great reviews.
> some other musicians that have participated in the past include sonia (of
> disappear fear), and melissa ferrick. this year, queerstock is
branching
> out and going to boston and new york!
>
> the event in boston runs from thursday, october 21st through saturday,
> october 23rd. the atlanta musicians heading up north for the shows are
> cooper seay, commonwealth, doria roberts, and angela motter.
>
> here's the details, in case you are in the area, and would like to check
it
> out.
>
> when: thursday, october 21st
> time: 8:00 pm
> where: the midway cafe, 3496 washington st. jamaica plain
> artists: angela motter, the steph pappas experience, mehuman
jonson,
> and surprises
>
> when: friday, october 22nd
> time: 8:00 pm
> where: allston area - call for reservations & information:
(617)783-8244
> artists: commonwealth, pamela means, gardenverge & surprises
>
> when: saturday, october 23rd
> time: 12:00 noon to 5:00 pm all day (note - this is during the day
on
> saturday)
> where: the milky way lounge & lanes, 403-405 centre street, jamaica
plain
> artists: cooper seay, doria roberts, rick berlin, tara lynne, cd
> collins and pincurl, robert urban,
> jessie zoldak and band, letta neely, and surprises
>
> for more info on any of the atlanta artists, check out their websites:
> cooper seay (http://girlsrock.net/cooper) (note: this is a new website
> address for her)
> commonwealth (http://www.monsterbit.com/commonwealth)
> angela motter (http://www.angelamotter.com)
> doria roberts
(http://www.geocities.com/sunsetstrip/diner/1752/lilith.html )
>
> for information on queerstock, call 617-983-8884 or go to
> http://www.hanarchy.com. it's going to be a great weekend. i'm going to
be
> up there myself, so hopefully i'll see some of my wonderful newport
friends
> (bren! sarah! laura! sus!)
>
> =)
> lisa
>
> --
> please do not send long non-indigo girls-related forwards to the list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 04:39:13 edt
reply-to: oyster toadfish <chickenwomyn@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: oyster toadfish <chickenwomyn@hotmail.com>
subject: re: ann arbor show is misprint
x-to: jennieum@hotmail.com
mime-version: 1.0
content-type: text/plain; format=flowed
darn it, i go to eastern and live on campus, but its still not a 5 minute
walk! its at our new convocation center. its a darn shame you won't be
coming into town far enough to see our...um....water tower...he he (think
phallic- its really qutie scary, you wonder about the architech....).
i'm working on the hook up! my friend might get to wrok back stage (and
because of pep band, i know the "bowels" of that building :) )
anyhoo :)
**jennie wrote**
i saw someone kind of alluded to this earlier, but the ann arbor show on the
official site is a misprint. i e-mailed the university of michigan ticket
office and they said they had no idea why they put this info up, but the ig
were trying to book a show at eastern michigan. i guess they succeeded. so
they are no longer a 5 minute walk away. darn it!
****
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 09:54:36 +0100
reply-to: john bond <john.bond@lineone.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: john bond <john.bond@lineone.net>
subject: re: nigc - smashing little shindig, movies, breakdown ...
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
well, i don't know whether it's the standard edition or not (it has 11 tracks),
but my copy of breakdown had a full lyrics sheet....
john.
lisa r wrote:
> on another non-ig topic...did anyone buy melissa's "breakdown" - i bought the
> ltd edition version with the extra tracks but there are no lyrics included (a
> book but no lyrics) i was just wondering if anyone had bought the standard
> edition and if it came with lyrics...i'll never understand why people don't
> include lyrics...
--
"every sperm is sacred,
every sperm is great.
if a sperm is wasted,
god gets quite irate..."
(monty python - the meaning of life)
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 07:47:24 -0400
reply-to: neil <neily@netreach.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neil <neily@netreach.net>
subject: re: breakdown lyrics...
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
>> on another non-ig topic...did anyone buy melissa's "breakdown" - i bought
the
>> ltd edition version with the extra tracks but there are no lyrics
included (a
>> book but no lyrics) i was just wondering if anyone had bought the
standard
>> edition and if it came with lyrics...i'll never understand why people
don't
>> include lyrics...
the lyrics _are_ included on the limited edition thingy. they're part of the
multimedia extravaganza... so i guess you need a 'puter to get it to work,
but...
as for not including lyrics, i think if you get seal's first album he has a
cool explanation as to why he doesn't. basically someone could hear the
words completely wrong and the song would make more sense to them than if
they heard the correct ones (don't have the disc so i can't quote him...)
@}--,--'---
abi's page!!! http://www.netreach.net/~andineil/abi/abi.html
this week, neil 'as been been mostly listening to:
richard shindell 'reunion hill'; lou dalgleish 'calmer'; the jam 'live/dig
the new breed'; bo diddley 'the chess box'
song o' the week: 'nessum dorma' - aretha franklin
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 12:11:52 gmt
reply-to: athena - <igae@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: athena - <igae@hotmail.com>
subject: help to unsub. please
mime-version: 1.0
content-type: text/plain; format=flowed
hey hkfs
i need to unsub from this list temporarily...but i forget how to do it, atm!
can anyone help me out asap, by private email? sorry about the lame posting
but its urgent!!!
thanks,
athena
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 07:39:38 -0500
reply-to: sheryl jones <sljones1@facstaff.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sheryl jones <sljones1@facstaff.wisc.edu>
subject: boys just laugh
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
i read in an interview where amy refers to this song as "measure of me".
----------------------------------------------------------
sheryl jones
sljones1@facstaff.wisc.edu
cooper seay page: http://www.geocities.com/felidae/cooper/cooper.htm
bootleg page: http://www.geocities.com/felidae/boots.htm
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 09:01:20 -0400
reply-to: neil johnson <njohnson@jheng.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: neil johnson <njohnson@jheng.com>
subject: re: the midwest conspiracy
x-to: aeig2317@hotmail.com
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 8bit
i think they are hoping for snow. or at least the cold to remind themselves about the climatic advantages of living in atlanta. either that, or they simply like teasing us
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 22:11:27 +0900
reply-to: "karen, the biggest indigo girls bitch of japan"
<prochoicer@gurlmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "karen, the biggest indigo girls bitch of japan"
<prochoicer@gurlmail.com>
organization: gurl mail (http://mail.gurlmail.com:80)
subject: hiroshima (nigc), but please read!!!!
x-to: indigo-girls@onelist.com, girl-music@onelist.com,
womynfolkartists@onelist.com
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
hey y'all,
this is completely nigc/non music related, or whatever, but i will post it to these lists anyway.
last weekend, i traveled to hiroshima. i was so touched by what i saw, especially the memorial to the children who were killed as a result of the bomb. surrounding the childrens' memorial, there are over 1 million origami paper cranes that people have made. i was inspired, and i decided that i wanted to get lots of people involved in making cranes and send them all at once to hiroshima (and bring about half of them to nagasaki, when i go there next month).
so i am asking for help. if anyone out there is interested in making an origami crane (they're really easy!) so i can send them to hiroshima (and bring some to nagasaki), please e-mail me privately, and i will send you my address. or if you prefer, i can get an address in hiroshima so you can send your crane(s) directly.
thanks for reading. i am sure the people of hiroshima and nagasaki will really apperciate it.
peace,
karen :-)
---
"one day the war will stop, and we'll grow a peaceful crop, and a girl can get a wife..."
-- emily saliers, indigo girls (goddess)
"...i'll be at the rainbow room, i'll be courting some disaster with the melbourne wrecking crew."
-- amy ray, indigo girls (goddess)
http://userpages.wittenberg.edu/s00.krosenblum
http://www.gurlpages.com/activism/prochoicer
prochoicer@gurlmail.com
get your free gurlmail at http://www.gurlmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 06:33:21 -0700
reply-to: melissa gordon <melissa@ce1.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: melissa gordon <melissa@ce1.com>
organization: creative endeavors
subject: stomp & stammer; cons review
mime-version: 1.0
content-type: multipart/related; type="multipart/alternative";
boundary="----=_nextpart_000_001f_01bf1b8e.2b295be0"
this is a multi-part message in mime format.
------=_nextpart_000_001f_01bf1b8e.2b295be0
content-type: multipart/alternative;
boundary="----=_nextpart_001_0020_01bf1b8e.2b295be0"
------=_nextpart_001_0020_01bf1b8e.2b295be0
content-type: text/plain;
charset="iso-8859-1"
content-transfer-encoding: quoted-printable
well, this should elicit some interest (from a local atlanta =
culture/music publication, which i actually enjoy a great deal).....
from stomp & stammer
indigo girls
come on now social=20
[ epic ]
musically, the new indigo girls album kicks off with an incendiary =
blast: a crunchy, amy ray-penned slapshot called "go," marked by the =
pair's uncharacteristically nasty rock 'n' roll guitars and ray's raw, =
passionate vocals. the tune harkens positively to neil young's periodic =
work with crazy horse, and sets the tone for a radical, and most =
welcome, upping of their creative ante. alas, it never materializes in =
what follows. cut number two, an emily saliers composition called "soon =
to be nothing" that sounds like it should be sandwiched between john =
denver and poco on some '70s "ez lite rock" fm station, makes for such a =
drastic and immediate shift in mood and tempo that the urgency of what =
came before is soon forgotten. what seems at first glance to be an =
effort to hotwire the atlanta duo's pop fortunes by making a =
star-studded, musically-adventurous statement is in actuality just =
another indigo girls album.
which is not necessarily a bad thing, mind you. there's a lot to be =
said for the comfortable and familiar, and the indigo girls have =
resonated with such a dedicated following not by faking hipness but by =
conveying a realness, a conviction and an authenticity that most other =
popular entertainers simply lack. as people like young, bob dylan, and =
others of their predecessors who have also straddled the fence between =
folk and rock discovered, when they strayed too far from what the =
simplicity of what they do and tried on different trends or pop sheen, =
it more often than not fell flat, because it obscured their true =
strengths. thus, while come on now social has been suitably lilithed =
with musical guest spots by joan osborne, sheryl crow, and me'shell =
ndegeocello, their presence on the album is, wisely, hardly noticeable. =
if you didn't realize in advance that they were there, you wouldn't know =
or care. they neither add nor detract. meanwhile, ray and saliers =
continue their incorporation of traditional acoustic instruments like =
banjo and mandolin, to great effect, giving songs like "ozilline" and =
"gone again" a homey, warm southern ambiance. the only songs besides =
"go" to really rock out -- saliers' "trouble" and ray's "compromise" -- =
do so with vigor and confidence. i really wish they'd do more of that, =
but then again, that probably has more to do with my own tastes. i never =
cared much for poco, anyhow.
whether political propaganda deserves any place in the rock 'n' roll =
world is also, i suppose, a matter of taste, but obviously the indigo =
girls believe that it does, what with the causes they've rallied around, =
the lists of activist groups they encourage their listeners to support =
(mostly environmental, gun control, feminist and gay/lesbian lobbies), =
and the highly-charged leftist content of many of their songs. while =
it's no surprise that i don't saddle up with them on many issues, i can =
vouch for the sincerity of their beliefs and admire their ethics. but =
really, amy, you're going for the way-too-easy heart-tugging tactics on =
"faye tucker," the closing song here (prior to a pair of bonus tracks). =
it's a mournful elegy for the first woman executed for murder in texas =
since the civil war, complete with the angelic vocals of arabic singer =
natacha atlas, but any way you look at it, ray's philosophical =
presentation is flawed. "well mercy could prove us," she sings, "but =
nothing would move us, to rise above just being cruel." now, wait a =
minute. is she saying that that, because tucker was female, she should =
have been treated differently than the male inmates on death row? that =
would go against the supposed cornerstone of feminism and equality of =
the sexes, right? so the message must be that capital punishment =3d =
evil, a view which is backed up by the girls' listing of the national =
coalition to abolish the death penalty in the "resources" section of the =
album's liner notes. but do you think ray would ever sing some weepy =
song mourning the execution of a guy who raped and dismembered little =
girls, or dragged some black man behind his pickup truck until he was =
decapitated? hell, no! to do so would cause ray's listeners to question =
their blanket acceptance of the indigo girls' anti-capital punishment =
stance. such horrendous murders do not lend themselves so easily to =
emotional pleas for leniency and calls for re-hab hand-holding. was not =
tucker also "being cruel" when she committed murder in the first place? =
such self-evident details, when pointed out, crumble the effectiveness =
of protest songs such as "faye tucker," exposing them to be =
all-too-shallow. it's a consistent failing that the indigo girls would =
do well to overcome.
=adjeff clark=20
------=_nextpart_001_0020_01bf1b8e.2b295be0
content-type: text/html;
charset="iso-8859-1"
content-transfer-encoding: quoted-printable
<!doctype html public "-//w3c//dtd html 4.0 transitional//en">
<html><head>
<meta content=3d"text/html; charset=3diso-8859-1" =
http-equiv=3dcontent-type>
<meta content=3d"mshtml 5.00.2614.3401" name=3dgenerator>
<style></style>
</head>
<body bgcolor=3d#ffffff>
<div><font size=3d2>well, this should elicit some interest (from a local =
atlanta=20
culture/music publication, which i actually enjoy a great=20
deal).....</font></div>
<div> </div>
<div><font size=3d2>from stomp & stammer</font></div>
<div> </div>
<div><font size=3d2><font face=3d"arial, helvetica"><img align=3dbottom =
border=3d1=20
height=3d150 =
src=3d"http://www.stompandstammer.com/cdcovers/rev1mini.gif"=20
style=3d"height: 155px; width: 158px" width=3d150=20
naturalsizeflag=3d"2"></font></font></div>
<div><font size=3d2><b>indigo girls<br><i>come on now social =
<br></i></b><font=20
face=3d"arial, helvetica" size=3d-2>[ epic ]<br><img align=3dbottom =
border=3d0 height=3d13=20
src=3d"http://www.stompandstammer.com/fourstars.jpg" width=3d149=20
naturalsizeflag=3d"3"></font></font></div>
<div><font size=3d2>
<blockquote>
<p><b><font face=3d"arial, helvetica">musically, the new indigo girls =
album=20
kicks off with an incendiary blast: </font></b><font face=3d"arial, =
helvetica">a=20
crunchy, amy ray-penned slapshot called "go," marked by the pair's=20
uncharacteristically nasty rock 'n' roll guitars and ray's raw, =
passionate=20
vocals. the tune harkens positively to neil young's periodic work with =
crazy=20
horse, and sets the tone for a radical, and most welcome, upping of =
their=20
creative ante. alas, it never materializes in what follows. cut number =
two, an=20
emily saliers composition called "soon to be nothing" that sounds like =
it=20
should be sandwiched between john denver and poco on some '70s "ez =
lite rock"=20
fm station, makes for such a drastic and immediate shift in mood and =
tempo=20
that the urgency of what came before is soon forgotten. what seems at =
first=20
glance to be an effort to hotwire the atlanta duo's pop fortunes by =
making a=20
star-studded, musically-adventurous statement is in actuality just =
another=20
indigo girls album.</font></p>
<p><font face=3d"arial, helvetica">which is not necessarily a bad =
thing, mind=20
you. there's a lot to be said for the comfortable and familiar, and =
the indigo=20
girls have resonated with such a dedicated following not by faking =
hipness but=20
by conveying a realness, a conviction and an authenticity that most =
other=20
popular entertainers simply lack. as people like young, bob dylan, and =
others=20
of their predecessors who have also straddled the fence between folk =
and rock=20
discovered, when they strayed too far from what the simplicity of what =
they do=20
and tried on different trends or pop sheen, it more often than not =
fell flat,=20
because it obscured their true strengths. thus, while <i>come on now=20
social</i> has been suitably lilithed with musical guest spots by joan =
osborne, sheryl crow, and me'shell ndegeocello, their presence on the =
album=20
is, wisely, hardly noticeable. if you didn't realize in advance that =
they were=20
there, you wouldn't know or care. they neither add nor detract. =
meanwhile, ray=20
and saliers continue their incorporation of traditional acoustic =
instruments=20
like banjo and mandolin, to great effect, giving songs like "ozilline" =
and=20
"gone again" a homey, warm southern ambiance. the only songs besides =
"go" to=20
really rock out -- saliers' "trouble" and ray's "compromise" -- do so =
with=20
vigor and confidence. i really wish they'd do more of that, but then =
again,=20
that probably has more to do with my own tastes. i never cared much =
for poco,=20
anyhow.</font></p>
<p><font face=3d"arial, helvetica">whether political propaganda =
deserves any=20
place in the rock 'n' roll world is also, i suppose, a matter of =
taste, but=20
obviously the indigo girls believe that it does, what with the causes =
they've=20
rallied around, the lists of activist groups they encourage their =
listeners to=20
support (mostly environmental, gun control, feminist and gay/lesbian =
lobbies),=20
and the highly-charged leftist content of many of their songs. while =
it's no=20
surprise that i don't saddle up with them on many issues, i can vouch =
for the=20
sincerity of their beliefs and admire their ethics. but really, amy, =
you're=20
going for the way-too-easy heart-tugging tactics on "faye tucker," the =
closing=20
song here (prior to a pair of bonus tracks). it's a mournful elegy for =
the=20
first woman executed for murder in texas since the civil war, complete =
with=20
the angelic vocals of arabic singer natacha atlas, but any way you =
look at it,=20
ray's philosophical presentation is flawed. "well mercy could prove =
us," she=20
sings, "but nothing would move us, to rise above just being cruel." =
now, wait=20
a minute. is she saying that that, because tucker was female, she =
should have=20
been treated differently than the male inmates on death row? that =
would go=20
against the supposed cornerstone of feminism and equality of the =
sexes, right?=20
so the message must be that capital punishment =3d evil, a view which =
is backed=20
up by the girls' listing of the national coalition to abolish the =
death=20
penalty in the "resources" section of the album's liner notes. but do =
you=20
think ray would ever sing some weepy song mourning the execution of a =
guy who=20
raped and dismembered little girls, or dragged some black man behind =
his=20
pickup truck until he was decapitated? hell, no! to do so would cause =
ray's=20
listeners to question their blanket acceptance of the indigo girls'=20
anti-capital punishment stance. such horrendous murders do not lend =
themselves=20
so easily to emotional pleas for leniency and calls for re-hab =
hand-holding.=20
was not tucker also "being cruel" when she committed murder in the =
first=20
place? such self-evident details, when pointed out, crumble the =
effectiveness=20
of protest songs such as "faye tucker," exposing them to be =
all-too-shallow.=20
it's a consistent failing that the indigo girls would do well to=20
overcome.</font></p>
<p><b><i><font color=3d#ff0000 face=3d"arial, helvetica">jeff=20
clark</font></i></b> </p></blockquote></font></div></body></html>
------=_nextpart_001_0020_01bf1b8e.2b295be0--
------=_nextpart_000_001f_01bf1b8e.2b295be0
content-type: image/gif;
name="rev1mini.gif"
content-transfer-encoding: base64
content-location: http://www.stompandstammer.com/cdcovers/rev1mini.gif
r0lgodlhlgcwapcaaacjb1+fsoqibkzctcdge7wgse5khlkms0ckb1fljthgfodih8lml9vnlodn
klool4ejvqsmc4ugolbjv96lwdpkwmjmzydpz0gogoaqiyuje2cqfnnhhrkke+dl2hbokccpfa9n
midqv+alyj5hh7s4lfxlupbfgukrsvxo06dkgyckbyffwykrn1bwh7oyui+xe4uvqt5hfnbivnlw
zuc4ivfzlokqd6ppxpcoj7o3c3jqzoi4kilwicy4m4p3mcdfuyo1f2mgakh2s3j2mfn202cuplwy
f3vwidpyh0buf2c6hs2iwui1d/fyehmxdmypkiksrf5npugyzdva4fpzunv4z5uzmouiuvrjnscz
ei94z1vync6mcve5kmlczxmmn8dzqoj0ryyjmgqwwnd09m2ze1g4ichhz8+wzi+1jjfnri5znlcq
f65qrhaibakzd3c5hkcwpfbzv5+ju+l7pre5tqtzhsq7unefl5mjudc5hhbqqjcpgkczfebhlnrh
n4sre7vhbz9ixyo6fqdbukjhsniwcmf3yqo1cmttiksada95yaa6hec6thrauio5oak2tosbefbk
lipugyy6bixbuunwmwwbdcu3c40xd6g3lsmlekypjf92qyx6krkobmdmqffinmpzwubwsidqbipl
mfapdk5knaknmxsumfj4j6xfig49q/nwonmgtz6mbcdhi/arixmhbvwzy3uuvmdqucls1spfkoel
btdm1+lm6unhny14r9jxoruyj2byc6hbne4ckkt4hlgsr56koacjexjkm46wweg7sfe2ez2jne3d
4og8npwcfiregf9jyo2lwplqyxcqd7h3sup07vg7uz+ywao3r8t8rrwhyn7lrvhr7xr4rvb287oc
mhzxoxh4hhfydvnmtedffxolejlltjyjbjkdqtgzdvr2tro2ftk5obg1rsh8xmtn4ebulhcjb2jg
h2bmj5dkh5dlkeandrdnetgqp15zh7syzg5lct/zzmn0j3fqgzhxhywaaaaalgcwaaai/wcr5kmd
6ahbiim4fvnozdsufty4mfnwpkhfinwsattickphjx899oiaqkunmyzradjtqw0hdummtgntzwuk
divsxwvxbmctgvhiayi3r2jqnlp6pjear5zteflqwouthzwqw2wq5yarlse7amogdapwbzfzcldk
gadxpxwaa+rutro3bugcfn5spnjwscliv4ada8zo7rs4dfqgrgbqy4wwlgs2sbf27gygy1ropnsc
dx1sr0hjaqernhfqeenr/zrtviu8ghhq9emfc1e1bx4s2pb2bc46umr3cas2ibqbautasfua78ab
bdfwwmg3z0+ngvmu8ku4hbbfbxevcv/2bgxch9eogqapcoaos2ftwqxdmn+yzpnaakadnrjf0tia
ajfysfh8asave5tjwa3w1ccpfrnwao8nurqhrasb5adpouumddtthuaiyhbrtsauch3ikfg5pa0f
aosgcegmax4sfndcfx1h2hg8jrpfg/h0gc9qwsrmit6llchmelmck448z1h2zaqw6xtgex2ybmak
uyhgpybzpvhfwgjiai48d8lwyjrwgeaklwdai8u6tanxfrc3ecaekb/8us4vt6zqk09leqpaow2x
mguw1wgsqiy/kkcoxxjtykngupsawqrxadvuc/ljm4rlbvi2agzscidmiyvi08amwat/49gerwmx
mryrfllzli24xzotnwrxxim1sjednpvmagm2msdbixszvpmfddngaokhuutqj6dxkaxat2j+e2al
34omw3ug5jppeu9goce1voibi46xapzcaqtgsfqw3/6ibbkddleib20cq98zl3gaxa7pllgencjc
ke4ffvxhmhy1aehifa069kq5y5wjzhzvvpgfbzbyqbyih578xtt7tvmhk2qss1s4/yorrlbd8qza
wkhuqoieh7p4bag1fnalfrhii1ak83beow9rcibbpcty860w+ah1bbic9laeejwkg/blbbztxhic
hlpegumcbbt9l61wzaxlnggnzlng/xykbmfcfuynv3htdta/1gbtopuajuquimdhldwridmozphn
lm45lzb49its7rhmfy4gkw8imrjggh5i3cj1xyk8seybi6wtbvimamdgmt0kvdehs/dewynnbgaj
ofudfqbzgbcfzjecwbklzdasygp98oiaqr9+nftnloio8guiqiasaflwrialkrfkfrnm7jsfgpjz
p9ecirjpitoiewqhwx4yceiq8ogfa8biuk9tcnqgawvtmaidq1nbi7awuypwbgk96mezvuaadstb
fd3ixxmwyik1gamcqppdlgoadpdaz21ua0or5fety0cjdtpzacoukqnercmc61adbf9wmyjycqgx
6ynf5okiuaoviyndop+ajtyt/v3pafnigghuqjeqfcarctggxvkgjnekbc8p6aihhkct88idz1fy
wtmksyzucyans1gbomc2hnpk4ytiawce2bcgjtgahgcahyel2qnlek9uziqbzszbgtuabgupgama
saeepnchcrm4bclwcqgh4oi3lnufeocilgobc2c+8ddqwhuo/tgkhuh4azt2oqedbkeplvgamnrq
gky4yhyuokypkoaas3akrrgqrhqiiiizsaehhssbjejxbksgor5xmmeoeqknfvrtcirexgmr0atl
lgei0qbk4orhhgy8ka0oskqfsid/a5szwgk44iwihcceh5jienqkqptwqzodhchaghpcrfn0sok+
isn0wwskcoki5badhlvcqw3sxyekxcky5agbb/rxtu6dyrglqecel9cgrwzafhgghjycswvwlcao
xzhgh45xbdqsqrtrsmqx5lggdl6gf8diqjrsfdr89mjs9orapasxvfguyrcg+bypyccwqcbbroug
hcc0cqa3iauw35rakiukkh+jcvctdas7qucniljlyx8dxrb2cccq/q8bgcdhp37qc041yiuyxyer
omebztjudunoradgsoeouakx4dhet+oxpdk8ygcxqcejtfhjmzigstnohtuhmar5/2tbdzkgbtza
aabivamgt8afjrrkckqgfaarcgvmzlmcxbljfxawqm8u9wt8uljbqzcou34xv/np7klz4xwcyreh
axhgd/dyawi6ciix9kadg0xhczlqggmebqphm8uqzlcbrayha704hx4fczl0oijas+jdn4bijuvs
ypqmsmqghtad5lwbgsfogwgks4a1rigpr/gdeoebcqaeiaeaveuufmgbxhjicuxswsq8qqx2fksk
3rbcfvlxlqtqwqjwmjgbwnc/h77saabwxc4jzbkwjdci/qsclkdqi0y8ob71qmj8tgdhnazaesdi
mykp0d8zmomggdiamesacvmli/8ll3kerlag4buswgzswmhb1uc2jxqhdgxjwbd+cugmbeednova
inawiwgi9amkuaupvqxc5dbyjwdygteke2mqpijc32khnx6hav3wtapewmogsggbfhgcr1cgxhm8
0ajx9isilqjvfrbwghpoo2bt+lab6mcgq2kbvfxowuzyem82nambrzcgnexrcgpynx7nmmjkadch
ytgmhudowpcxmitqgmmibdjamvqxhaluyw35pamfyte+ktqebqesxascglkn2ngn3wibv3dm6v9c
qdmwgjqhvoepyhgdnqbgxy7a5xnvaiad3kjcz3zhbqbugxjf7zafjkarfdgge/r/4aa4lga9zrzw
brrrgxvcwiyemiitooaejzogkwzi4xhmemu4hlafasycmt62hocx1ofhya0d2kccnobegcuq747a
aedqm1o5aociiyeiwebboztloqvz1gvafaigcz+moqxmoahea+cnkzjcg6c2qi6/lqpm9iqdca8c
n67wbcriojg05nz9huoalpdjw1ja4xpqacymtiiaieibg8lghlg4qximomhukjunitrhdkwygzey
wqezjamkdhawnoksntpofb9vcx7vzcdfitjgan+fhohwcgzigik34llovsxfdmciawjukgvedqea
goc9j+hwhihcwy1b4xgh3+jg/wxkuqwmhc0dggaamycwe9xcdwqk4h8fxtafoshdvg4cxxboww7h
2hpm6eyn7nadndamq8aizpabgcaewcaeasakjgaimybmjjahoqcacxambsapkyamj9qg7pagvodi
blbfk+bhvbagupatiga4vpbdibmoogmjvqajf9ity8avjgaaqhyf/sjde2ahqbepguemenbxqled
vbbwafabdgaaducdpeeb1ichmaaahiamnvmdf+bxifafvtaeadali9ahfebgetm8whigaycateun
jnamriacjkan8sqnn+amaayfugacuoakfugkpoafc8adc+afbyapj5a3byadzv9acyoudnyavcsq
hmwadvzsarbqeekaxieifpntxjmwbpfte5bqyhaadrqgst/1cxngyy2yc9xaayihagpay+rsdh7g
d1dqdqdonh3adi9smq7wa11wbfifauvqc/qxa5usgxeqbpwah+7abo6gc8pabh1gaibacxggc2aq
gklqbxngaooydamia6ygcq5zbczfafbaayxgw8jgjtqwccugdqvqyqzyctisa/hjbxbapvwdaito
btz2vjutfhx1sqibgkfdhaaabfvaaxohcetcxqaqbdbyfkcjqfpgaa4weckhjssgj/rhdy9whi3q
bgvabfoqbkxgbpkaa/iom1r/waxmeaycqia8iapmyalj4amkkaoofaeyyakoahnnge4dtgl44brm
yckxqgfrwavpiaqvuq3m029kaqkiwj9puavxcaawww5zubyvdwopggo2nirckr+y0ydnyq6qgajs
sact0ad7wa7lyab88aeoqa4/mb/ncagwsajuk0e/0adn8a9mya/2kaeyqsovyfztsapgka5euaju
walq4awiejo8oibpwaldoa2jyakiwg4vhqai4dzfpgu7kauzy071sahw8en+wjvg0hvn9aqclcbc
qhhova4g8h5c8dpxahfpmhgt+qcakaqpkhcztgogiixmfnbzmagq8adt1pel/8ih4kapdlauz7af
lnaocqa4x6atadbu/0abcwggziak7maj3baokcacpwab0damzlcnacadjpabomkpzqcpqfkijiad
axactqa9gwaodqnzxtahsricomab1nagfialygkb5zbocwvlfnuo8edx73c73yuaevcjana51ecn
0qdpoxaoecaumdalvhbcbqfwu1qondanrtuszyap6nkodombjjioascp9tafztafxialv1oiisap
lncfc5ea9sae1madgugfxmapbcaibbag0pamyraw9vaahdrterqim9by6haqzsabbraboyafevad
ikbvmshq/qm05ebxrunelv9aivfadbzzbcqqvlfadvwealnadtxwbzbqbodzbziiazdwaguxb3zw
i4eebpb2gyq5aq1wjfdpgigqbrkggpaaptzacdpwccuwdlqab8oqdk5qachgeow4gntgbozaa0eq
by4qodggaguqnhdqmm8zjegqd2ygdrvgbkvab7yqxwx3bavllrupl3+akyn6ik6exh+5fk+gd1ug
d/ggcvtgeyawy+fada8wo9xnax/wbaela0jydsvhvxtwbijpf3hzztnjgtepbzbgblpgbrnaa4oi
oczgbilacrlgbrkqdckgckoqdwbaa4uocw6aa9owb4/wc+3aarwldmnqcix/yeivcq5pozcasayh
gabg8weuwg8kcve0dk57gat2izwfsw4ctfdel11fciuwyavfkjzewa8/m52bznerbwdy4a384hrf
ylb7uavz0a1x0g180auwaq6ycx81cazciaw32qfgeal24awdilezkazckjssiamymafjoa1mklgz
maczmao5zwj4cawlwak/mailmazawajusazxwaatca6rcqb8qgdigtx8iawh4kok+v0wlusvsgeq
ah+lcjs4ijwjenh88wdvcqbsuaq0gjwagayprwm0qdrn6a1+uzw5kalv0itvudfokw9i8hm0yqct
cge2kq43yq5s4ab2oazk/yalsjczsmachfio3ogfzsaju0abkicageao/8csd3alk7skv7ak/lac
zcadlraabmaeolsirtbb2hahg1aqvqb+q6q54imc8umixzgguxscuazxp+mhr6abtxmedkafgqcv
q0efd0cmq8govlabrxcf5vuofzapj2q1jokbcmm1dsmvilagjcczpyalzpabhcu+fcgm5isj1jag
p0al7+sfkjakwsajcwai/eamvxaf/san33aemmaijoag1iaj5yawsyapk4bdbbmifnbxrdta3wke
7pqi5tblugypucbaabshxpahf8affpwh3zwpaqccsxae+gmdfqabpgoitv8qsexab1qgbdiga1vw
qmztbk/cb/iiasewdsgyd9kgdzkpdm7gdojrsbigcqu5uo0rc6fgdesscrsgrgz6sullbpygdk1q
aaeodw5ao78wpisgdc/wcgwjadlzrntjkojlv0ajhfdwhbnec9flafytx/ytbx+wb1labsuxaqki
ax/tl+ffk3uqacvqat3gb3+pbc5gaeokpeugmfpnpzucaedgbqycbk2qaeklpwbqbcogcteqbpiw
aipayplww16gh5labnkaod4cv3eqdam4budmdyugdfpqdw0qb2+zavgrnzsadzqjusgpx93lfmjz
hxpmk9dsl7zep5ecqhj/xank0a8uaasykcir/aeq4wiyiaxduf7zyaauka98edzx4nfochkbubll
nafsca5x2gs3iqxik5kjcnxja7e3cao4kgs3waqzmarh4avc6c+iiappka3zcanucaw18av1qdaf
854nkzd8qlrrzipkocfmtdqsks1skv7q7d/zoatw1w0uaajsiagyqaraaaie0abkuavqbx9qxgsg
aa9c4aijaa/5waxqmg+vsaxfxdzylsxtibttog1m4aarmkwtqyaiqgz2maksoayncark0asimau3
ya8/aazjfqmuqae34axjellmkanrqaehgawika5pke9pbqltyt0csahs/wbb7gm/tsvmfhlymz1e
bcad5uaeyiafsaacjtap7/0etdaaraadrnmaeuae5bva/gpurv3zxcafccafbiaf0vep+drh7vlg
msegyqaii+agawagcy0lgwjqpswlyocyc0abfzscjyakpjwktadd0cajkmdbce0m0rag1lagiiau
febt56cub9zn4ccxc6leahr//iochsudsua/5aaimfaerr4lmhaluvaeeydkmkaw25ahe5dnwykd
nq0esgapliafludzsnanveaahuys4paiajitbsapbpmahpafptacu2apppzpziokzc0kehg/xnak
fealsxwdiec+tkchap8mctj5a9hgdqoawysgffy1gcdgdfgq1yqhway7ugh343515eqlxonqagae
argqce/qjrfgacxabeuta6+wdf3jc7vqc6/gpzotbken1figbbygbflqc73waxbiarxkcfpiqmeq
1dqbndowbzjac/3sbscw4npuanvhatqaonvu1bigcsgwzy0u0mj9a3uq3shgbh3am0g1gcjydk7n
afzcxpjdfi/ixnn5rnta6gncbw8gbvfic36acijctwapqeqwd0pt5tjwhfood0qax90a5i6wbvkg
as/abmwivg+zqyrjbzqkfe9wbfpgdijeqwjktyygdjpyk3pgcj6wecn/yal2sazrdcqzypkjdmvs
rvnac1fmg390iw9lwayqid7w05diwg5+haskukrlbuccggqdbrzzewrenibpkaauwoxszauzhckj
sm3l5qnblavi8agzsi/pyah5edx0mdgwcr1v5hnhiamnmak+zehwxof6mqdv2ghayai+kawwaay2
b4gkba/rtghlzgrusfndmweoatgkeqztse3uw4o6k7svm1gtaorwlwv5zmd7kax9a847ot9saox7
zm6piwnckacdncfwmpzeanrcgnoeka8voa8feacsja+lqegtaw1zujalaqbhiau0cpiylpovsbfl
6lexgaduil6j3i0m/0derjz3pwdtqozfq8ap/jift9ahpwuzjrqp5vrssnt6thf/cuirow1ape3l
qemtwggq8gqoizgg0twxlntimjbvxj8xcrlmk6gkgad5sjc8kkbvtlohfjzwkifhzjj0fayl0wig
3hbzuyqpy+dfiyhrjlyncyxkzoyuycyyylamhsnqollmscyjqwzzsm5i4ssee4p48dkla5pufwaw
bdpwonmhwjmnansuzdswwb94iabi+zofc4hyeehscrhehzqqe55wkwgaczstemiicgfckqqdbmlw
5tjrxsnuckvi+ddtg74ubyacksfvdbi2gokdabmizuqxa5rykyql6v9nutt7+pxjatdszd7mahrg
zkskfca8rjxltjikd0zccvvrj92krtxtcwgjr9czal/cok27trzapez+7nfgamqfedk6+sn35jui
jxuyzikhajmopeipr4weysechg5gsesahfxwiagx5peai1fywuikihwarz4clkccjprmiemmki7h
yawttdarhndsmwikqg67qsceksgptxs4mwnhki7wwoqd53cqowcyogqinsxzwromsenhixowcmcb
nwo4lzy0znkrrt263gozlp+irqzfphjcbth0koepp9h5io9tkaeabhwu0kmegrj4lakziusjhylm
mqelglrhq4jufvj/azrmxnibgyhocicpm7gdjx1w5enno/5ws8cem+ypyabcevmjp5zmygypopqt
zuefvjdemamyugein45bcssmtjodhafayceaemr75ylfilcrvcvl61igeec4a49yfjebcbga6cyp
pomiyg8qxojgf7l8+q8la4kijz8kesonn0dnisjrlpjohggisccnixd6kkaaefh4hamhzqghntue
osadxuvkjw1lujcjnllqdcueuxhafcg5gpvprxou8wkqwadgqhs2zthiiy3osueenccp4yxewioh
jlsqjudzk81ty9s/zjdiprccskqbw/h4ohufxgh3dwoc7kyklpsa/yuzf/aqoy89phhwhndd+och
bbvp5xujdsikmamcskoafdbagkoojjjnu2pimcakefzgjamzurcnybn66k0nvxipgrcerratjpyw
c45wqvluo1comwjlgaxqkgdsvmrxdp11ikdrl2o11lk8vasvqmgtglcim26knsgflriadi8znvid
6yregvdrhmduhyijepm3s3yqweiaj4r5izmchogfcxl66gejceta4jfkoljgid5akkeueuzozh7c
zlwjyxn4skedqkdiwcmnl3vqhhto4usb/lxubfliqity0wan9ciffoacpodbcy78owdbsksqiryh
lmdwcv36frxw9p8t+jtdbtkadxeiyeeziamc90ocewqqhfeiir8y0emdpocfxnwagadibycu8ymx
dkeekdkhals3haus4ajgoibaftefejihcwmywfsuyq9oumeuzqheiwircftqshzecmqpblkcwfev
dv1yg1oe0ssdpwmrlfqba941tc3yiaeuiea56gogzt0haqlls7tysp5pay1q61hpxucadbneiggw
8iqiehelggzgbuniqx7mkqdf5mefrbcebpcvhx8wwxdp6eur5dgeeqtuh0uorwg40iuqjomihmge
m9kbjhxeqxpekmknpjaczzaqazcyrsm60qkbaeiaajchler2xph/zuostmgablyiqzmcowalgek9
6kdadwhkcq+qghjc4mamgsb05eedsp7gxyeec4qvviib2jsfpfzbcnvquxdmeuklkkift7bddfzw
bxsialb5imea9ccdfijik0tobtj6mqkhymmjcijgtsarak5cjwp/6aiepugdhxthest4yzwsiqna
heowyhijd0jmgqjqqhdofmmbcmfn5tbnkjfoabqauj0+nkevxneienohgq+keyh5kaje3gkpqo1q
btq6d+pagjygqc1awugi1sa0khl4ih+kuaqr9ualfytifewggsgf0oa82ckpefbehasbbr10w3mq
kucrydg9inid/xu7seyf2fipfedjewaoh2roqkisigentulcbk5hd5ryy2mgs8ynqjekhmqhdjcq
msruqagqjem1t4jhmc6wgkvohank6qurppcqfutdbeayoymefzhcpqsvv8jlwqwknya8iqggkiev
dodoa7igh7xorz+s9yrfdcmiuhde8gqbjfeswqz50advjtena/sifwpqbyjo4ioiegaxa+yhnx5w
hvdzzqkbweevjlefb3gddysyqgy68cljnaiqtggzfwdhhr2frddpyezzqjgbr8tjsx1ywtm4xwhs
oecc3xjf8wtabqpuwabam4c9ccefeesdc3xy5b/mspea1iave/8iqu5yf6f5mfcv3cghcdccjnof
igbmbtnd+khjfnwgx+fngs+qka8tcimzzbgwn6rhjws0nrj+6j4zslaeyktyg8zibxr4oa1angik
tsbjmjdme4yzgadbhvwg0kabjjcbb8nywqq0oawgwwijbtidktgamleyjqttm8a8johjlrnaxmhl
bgkindtwpzxjnvdye6d0nsda4w8jawanmwgagucj1atcydfco48p5ieisbdeb2oadl/4qse+siep
rn0fhpgacl4ohds0/qa+vchcu6ccltzsjsjyaaa+gainceqq3jggfbvbjm2cyyaopodkpcokmlvw
gr2gyax1wmd/euqriyj8ga/u4kpd+sasgcigblkoxyqo2ifchzcd7ciat8orpvdwbt8d/9y6u5ea
kbxl4vhahskli6h7seaaonbbllrrcx3ksa8vkai/afebflqadw/qgbksgyf9pkaepthbjqig5ghx
480awigfqyham3amvkldtqhkmoibfaakuaimfir9iblc5wz1aap3dlcehe7txppqbtjsmq95cjtc
vmaxc3zmqi8tuqz7amkf6tpbpcbdcr8h3viili88vavmihpehiaebt/keo8+6dkzvlgln3td6sz4
adhynaj+vaepraabn1wfyq9e+bnk5eealgok+j10nz8rltow/6gnuuahk9djr9prhihhbgdgsiac
pwj1imsgq1etovwfqcxkkdbunsnhhzv2aid1en6te//dnebqgyqorwkrd3u+vjbsdabqaxkiqr50
oanq/kagvbggfrcqhchcaypgbjetumoghgdiarq4am7aaxqaarjwhqdzpqmkqg8ih6rzavbhbebi
cveya1cgna0ulefghawwgr2ih0vdgdaahutgeg/pguuah2jaginigqeabwsabvaahwkqgweivnpq
heubb/3kb9ohauukmidil3gwgd74ay7oa8nyd7loauooc77ok3zylnzjjpltwhviayi4gemqawmw
aci0advwhv/wy4yiiepus4m1k7aryaz+oae7adpvyjeclkxdilbwiict0bg3+adxwylfi4opsamt
nifh0ij4eaq+awuj2ip0yii2cidtaymcaar5oapoowfquaafyirmaiiehifroaowo50fmbbd+cis
6b0lkaep+l8+ibyqqmlaoaspzdkbsiakktu+ebdky4x8obip+kepmiapklgu8abd2auaqaapqaa7
oaecxan+8iykgaiq8ibqoahjcj3xc8rz5ibuo7auijuzagqeciomsacegajwqlqvaivkkiclwqrh
qaf0ccdtwiahgiif2aifcaazcdmeviauai0efb7/eh4j0c///zoubsacuocpipcefgcbpkgllfaj
dfqwoamdxks5hdibeagbtvk7giayekmxgvaadogmacgbb+chafscieadxfjgnssdqpse0cozcljk
ngxediq6bjagdaahkmc3n2icebwftlgeanccfdcgy5cgzrcervbbdhizntcfqngbevabbxgcnkgb
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
b9ggh3wbovadfccch+gffacda4af//o/a7ggingflbareogptkipvwgjlrcmj8scduis7hohjtud
sjgb4+ox//m7z8uhlaabkvg8ckthdesgapssvddhijagfvigb+agw6ig1yuc12ogb6gbi9icpjk0
kigcducc/yp4ryjggcvwhynqhku4hxzzgreygn8yah7ohqiaam/ggtiggqergli4bn0iiknpbzks
a1cabvgytd8ahv74gwtiw4dkwpfcd0oqi/4aqhliohjggxvdaivkibeatx7grpvldeopgi0wngcw
gs/bbw6qlmnyphqkn8+jgivwbhoqhnsoag6ih2+qom+wqadtuh64gcxicc+xbogzqwwthskigwmg
hzbggieipnjahy04aolhgyeyhzxqbl/whngqbl2ggngshhk4hi4gh0xwaanwrx3iwr6m0h/aahik
ghtrdgnhxwjzimlbg5hmichldmoaf3lbhi/eammlryyoav80byeknsw4bvagvbpjyldj0gbvgajj
oaynsazxwadr+9dxi7agfva0uijwcicxuiireaatoao3oidpean6cavqwiml8ipv9iy5maz8pim5
aich8mkicaaaifiqeacauizmujsdkaafamvrkapner59wd8jgcerlylgwka9mawxyaidojoskj+e
qmj7stx+nid7cr4icfa/49v5yalrrnptdmogrcdq0abu6abmeaahq4bzgijstuc9o1d01tn2xem8
wink4admman+kmsiq4meaqrwmizkuei5birhaajyk7dq8anxpqa5uaafyk9ylaa+4l9r0ifreigx
ipc0iid/kbacktcaksixkjgrbtlpp8i+euhdmd2gisnq56edanmd2jtt2nxkz7naqhuabzadbicc
ilbiarabqhw9p0xx0zm6bsirqfvxnavdckmcfyccoucwoxgep9bgh+gapgagikudb1cahziaa5ae
fvaauojla3gbczcahyig8gshajegecafwzaw/ualaakcpkhdykubvxcyv5ghaqlblqayh6ax3dmd
bpjgox3kco1tz6ualmabboced62cbzccfai9ouuopztndaygov3hnsnsohvra0ubptgry/ggo9gf
e+aepjisw6ccaiicurrl/vmbvmweffcvsx1mfakc+dir/yxri407kyvfhrybumnuat1rtaxpocuw
lx1waswqggsijycwakklqm0n0wz1hmxggmeqbkxgbicwal04b2iq2gzfjp9fv8rn3dqf2rtagzma
gh3oxtjkhmqybnojau1uqamzweszhlbqg1c4hhhahlmvg2ipghrogxroyrtiil+yzl2qhs4aqf89
xj5jf9zpdcmwl3ng4fhia1x4iwqovg943+4nusvigncwbarihl8wbg+whn1yr5/92e19vuidvcb2
pwbaaxpobsb4umewsmzibkzws12oabmimcqwbtk4afp6alara0eqbdmyovciaqkqyqd+go5tabko
j3hgb/9hzr14qig94ilacnlu4ajv64u8ed98ireknqtvsaxym0ae7llv+az2clbfeiqkwaa7sazp
2jfkmipios2h/wfbpur0fejk0adgqiap/qbp44c50azu8ab+8ifxkok+kgyswkopoga6egu++mgy
ryemyq75rk7yej0/cakm/ymacii+2i8m1b0ucognnjtsewvk0abkeiugegiflqfoniwllfl1tdod
cfkwswezaivxeavjsim0yityg1tjytz2pdfxe9lstyeuaicjieb+iffk8ieh8aypkiehob8bo4i7
9kss+aw6kab9yqofxal9yoa+2mwcayes2owpe4jukil/naewlfgdlbiximic5+2diebcjrqulnai
f4afgfbqbvdjb4vqxo1zboabaqeeqaisxgmcavhat/xz22rhdctalkbhivcfxvapnapfd+uhdegy
d/dmccadd3ihxuagb4gblpjiexgbri2ghyic+kvm/rg84mugudgmudaalvg4aaaxqxgr/yiyhdsu
e+gu9waii0aguuygighdyxo6qpxzqk0btx2hcdirpqbbuuiderihe5ys2oxkfj5cnibafpadr1wv
du1dfhg6yqic/iihqoagvy2fxmc5elcafgjsv9qbllcifri0vecusyileeclyhzexiigj4chkpbe
rehs/z2ogqvivj4ywy9ogpwdbxoagtjdhmrvxdolvg4oatzjmbrgbsf2bukia3eyax3+6uif2qdk
xyh4af+yv/jt0pigglfmhinqb1cghxx5b+xegmvwaz/ibd0wafh4bwwwgh4garuidwjwibdilq7z
riqj21itjltkgspyoed4hcoyloyabywyfpiof+20zuq2x/bl3az9s3hihhhwhcq5kugehwzibkiq
bz/16xpz4r9oxhsgqx/wza/aw6ddwzmoakv1bljwbxvqbf9ouf0agi+qgh94hvqaavagak/aagdq
rfrivoitaqdiaxzlyo7qkiy4fyklobb4hqowgi3osf8doebjcggr6gvofbrpetprteyhpe0924vy
zomteozb3ozxmiqmoinfmiz64iedft83c2kedkskvhvmalrwxtmfxznu0af1maqf0ixp20yayd4c
sabkkajkcai8oihpcici07usb262koiusczbgktzce2hpl4ucbpwayf86cj/y6ffnrcdmiaiowf+
qazzu++oo8dkt4yfaaktugfp3sph6aaj4ayfid0htfz05onqnc2lq25jzzn+gfeouwiht4ikad00
qindaiieyiv+kajwuaicwaclwajewhjpsici+xbu8pz+z6aw+qnyabdpyijlcdkr6sv3syamaohu
gah/u9qxciafquvk//ua64w6n/vuiqibbdibvxmhlwgfadiclgcgnriaakm3es1w9ex2n9wfbygc
5ncf1lvqyyq9iuadwfabb/ycw7gfbyagagiarhiaroafxyodxmifciadiscabvowetqxp8ghkdqd
w/sddqgoyeapchiibje2emahfexfkwjohqmaltcz1qsggpuac3rfto2dmlidktgbwrifjqaaeugb
dqcgnbgcm+ceh5fx6ezcn/zpzu8fcaw6da3eiigbswceo6ygw0cdd6igviadercateafeucfaq8a
aiaaxlacxtskv7uxckobk4chcgcacpgfle+pvhdj/wia3s2oabqhggboia/4emlwm7p3qxoox7qp
3ul1axoghbaiaqpggeaqbxngachirwwyhaxgamuwwwwv2sgw4ga1ayxga0332b0oxhgyh0myhafw
vkh/ag/wge1ybxdyh0saifgkkauiiioapwbbeuyreuqglz8y9nax0ceifbkgchgzvq4erxygqbgi
ui6ilt8gpdgq1+fppan7rorziuogfg86vqhxxo0glv22phirtppfggp3qorrmy1cgh5eri1z5yqh
k1gtrb2h4vmnn7dcudebs9zswg4lyoija3sxz11hvaxk16cbd29obqhzbaqmgxgflatilycsjzl9
cp/uwvlndzwldx/lalhhqi2ie7p1qyulai8u8fzak8lfshrpi/mpsrmeggqprcbilbrwaz+fvlh5
0mvspzdja2hrybbmtpgmoppkcdvofhtnvjoy8jycru+0zr2v5cbvco1duuywgvsthvxvrt58kapi
my40vn4brxyjxizcl7qrihgjdalb2gadl7hm1laqfbnaruwncyhfbpdwioqm8hahbskmuicfc/kq
0u8387swqd8yekkeg0uz5u0fonmwm3e7rpjngqk4csiiiyjtxaln8jick3pm4cskk4wdrxupzjfw
v1+hrquelsqjnxljevoca5nikaivugrfbrre0ld/ziujydblp+secekulyhhygiu8clde0fgfksc
e2rxmqzzvjlam/b0uyc8aaaawjrwzcodcwng8scejrlqiw219ampafco6m0ul7oi427e2khbeesc
ciiyp5xywo0jnfdvjfnfckuhv23hzyo7bbdkdtdvozdovujjxafichnluolbdyssoorhacziubda
qgr4ekrnnoc0xx7swcrdpgbgbajg8+sxqgmiqfzenresjeuwkiiwercy1fkldlzwolm1rfiki5ie
nmvnckx48ygxjoicao7knhqkww6f4eut2mittbftzmeulwzvox3itou1rwrmhjejouhasutq1frv
/0012myjaxefwpjknzzqqoknomp5kbr8gfcsavhiyuc4mrtwdryywwhfqzaecegei4hqdr817lld
fjue4qkesiqgxypwukfdwtcp6c0nj3tgihmnndiclat6oywyfdbasbyeymkgkauzovfh2i15k29k
zpfmmj7oi4o2z6raa8w0jmcyeb9cg0uxelyywjoejrabaqo9uqmfvuirt2bogqcefhs8wccdnwjg
yudw/aiase9eykc+m3g7hqeaykahervu9lfp/jsl0/pebihbfqcytavep9tbqaihuknngpkaikog
+szrzfogq09lwszkqjupzpzgwde4vkmd5d5qcf/llufiqy4dgvcbfhgiaqqqailgsi5rbafr8dac
pblehqsikwbkeei8rneniicig1iobwaooounqgro5zifh0kihrqagagxwaly+muptphkgxrygzxo
hbcmpieaiabgnprdjjlupsomgectjjedj60pcyoztgzk4qvjuemuooigwfibnlzd4hyecmeepici
gptpa0rahhqc8apergmdbmcf7acghxkugyimkscfobm7ksggjt2yxrmaseeatkakfliqaubqaiku
qwndmma8joccpxdlv97hh7+sjl0q1canefsyqlzlfveyqegmkouotyawxgmhgd1xi/065pnv2ep/
fjdwqxpewqding83b5epecirgdzkqqn9kaay5ig0bcwqascjwh8iwg4z9gfe3ychq+brdylyyueh
4sm8+gaaf/qihvgaare6yqwhsqez4cphioyxdy4q5svm8w52vbeoq5ybgvzglsicccoquaiqgcdi
oozglaoyy1cfy2uth+owb5jadfoqbtwyciicpejgloozjhzhh11sqpiegr0y8ja2inbodxwycqgk
mki+goajxcdhqxiaj5pcjq8dzicw5qgaemtdukitqjc0ggvpydmf88afuetcjg94wao+0skhgbqh
e9iivvk5gy1gqvcwwmuiuabl2vbpmu16zf8z/2ace6ghp3l0qaniahk3drelvngjbzlorz/y0i9x
figsjuygc5iaozzffar9in0t4pghk/sdc/fa2jzm2ce+8eeevkjqe8dyby74ta8f8amwetspm3hl
lp5aovm0cqmpxcao+rckv08lukuiygrmmiik4fqpvoiqibbczb/m4ayghceepdiapvhqml+arrd2
+ei1rpcppcdza3wgqgaokskl1gjnzsrtcpsaqrboqttlwicltvoeevhgavo4zcn9crkdca11wcbc
n3ohaaofceutci2/bunkxhnjclxyatr6eattlsesocoab0iwauuqsvyqalk1zctdoujka0waqv8y
wncpo3qhe9qwk4yk2qvbypcbsdcja8tvmqdargyj8aqjcadtpfzcefpssbc4yjkb/mfdwgdapbjw
ewqc4heygzrw5jgpfpjuu+cmb088fkprunioppahh6qabb6bfto8na4fmfaax4xdhrkrqgckrmiq
s1qsmzkbo+owcmp0qr/hgetyyrlx+hybchoql1m/glq8kcebr5fbziibczpgrcwtgqcisneccs2k
g9wqdvlnmahusiahwqib0ubhaj68wgu2irrpeikj41rprxapwjhaawe2eeghu+icb7gc0hgmiwup
maevqzo+szad0dmei4xskaykngikq0ggd8d/aq6wxgcxanaf/nbbj2rmarpbjyi2brwpv9xkhqdg
y73kowr9w6mc7yrmhgbgbtohnqhp6eyetqyridhkhlhylkz3mmmewizbczfkikmgky2awx+pweia
tgu3j4r1dtah4jzibgu8llg7ioyesbltgwqmjwlu+mcqzjcgjsgpvnzqhzdytgsabmmknrbbdftq
se8wql5cafsjifira9g0pll4gxtwdbb4tg0wjlfyip+adbb0catc4dlu++gjv7yih0rqpmj8toiq
wwukz6gcndjggfhyxafftdhiolacadzbdmlx5foi4y/f7iqzumgrp7pgjylwqh8kgmi/ena+/xxz
4ktfooeypaaoetiaadpvqqkwmskxkcelmklbffpwes7wqrkxkaivjgmalhwcevwohwzy8qqtxeoa
jejfamzbqqiqitiu6ec5uleugckdlkrjatr28ihh1kal43acyapjiii1grxh4aacmighmeadal+4
all+owslacaeajglfbrjjspwakwpyhbcuii+hiej3i9x6jvcons2vieuneujumarzemqkaamjiab
1z5dcisd8ygl/cetjmo6liqhrkpw6dsfwicsqqiakralxiinjmalgka5/fg/baesqacrlvhfwud6
aeawxmaooa7ciiixfftyiuij0jqjnaeclp+dhtyhiwcabywfmcirbtichvghp2ictiqdixrbvogc
dywh3oxapqybk5rhxunvlvqaddtab0iahepaplzdusbdp9iaeuarykkgcltahuqrnbkclrtrnobj
egwzf2vgrfrcpmcbjxbaozyi6snb2nmcj3tdhqzcxtqtcngpdsifp2tbdlgbhpxcwihdsxkbe9td
bqsdfjjybmzaj/idp4yb4gfaofrapewadrgcabjehniktqxbmnzncugfvozdcetdcbshc3fkxoej
dxwbh/waeetbnagofvsci8oajydaokyqthhcku3hzlgdb+icljybj60oeytlfvsbntabl4h/ywt6
zpa9gg0ksukbwbvyx3ug14r4sw/kaxa+qj/hzyutaduugjmiqb+wqxgkghvyqdiegz8qazaaado4
qlhcqtbsgbpzdzmmwtrea1ihiiq4wxruas1eqx1kqz34il7pqjxagataqb4qgan9asj4qnaicy7a
qqrsgi8qwboww0xirmttas4qqaswwwq8hazuwna8arf0arjiabecbiyurdd4qqq8bciqaeawxdoa
x5jj0c7swiu8whzsgckwaeyvqbhaqwz0adgcgtemassmwrjyoi22adtugu5qafxlhyh2wql0wrqe
amso4jh4avtqahoeaaweqtjwh3jogjfu/5psuecduiaexim+5fhnie0qgaik+bsizaeiwqtoneqg
ggaa7ma8bfk+0opz5yn3pyyusiye3jde/rwb/efalketxbcw9itr0iajvifc9saitaehrie92emx
emecmmifkekfwinghomfwaawaim/pifu5jx+eymzqivvteeiqmadrimxbnsubgyy1eeddenceekr
nahdhiasgeacbbkd8ae4pjatyuaegibkbye8rr159qnjca23lcihgialde0+9mih/fucwiyb9aiw
aig4aeacvaippievoi96oodozjjofemn7maohmminimrweihqeeymmeilii0nniytibg+v+drk6a
p9gbaitjehchlcwbndrbnijchfhpf0wdjhacazdahdxbaddcpfill6spl3dgb8qalcxkpjiabozb
k8ccc5regtyekufevewbhkkbhfyaugenvdveflmandgpgcudzxmao/mbdahboqict/gk8+hkjtky
n/cdizzcerzdavtoozxdj6adkwqagxtcgadabixbohycetqcofxbpaskvkgfcyrantacyygcodcz
kgqdptrcixcczkzdioqgnz5nlcadixxayhxidxyaflrblliavhfaftzxtsjbhxasu2qbantaarrd
ptajgdwkegridbgaceilt9kbpgtlonx/wysi2qchwhlnqe/kclvurauyax2wqtcyasmsqbxwqae0
grdmwqgwahs4gplaijbuqqvsk/qjhbafhq/qawmoq0kjh3qq4clccaueql6hwuhrqrhaabbowqea
qovi0g/eakucach8qjlpst48ayjwtu2rwgtsqt7mkxdyqba4qlt6qux4jez4qyhgwriqrdeg0r4o
as7edmlmfyp5i0qby6aobxt0wh3qg4znpjlsp8mqwxqgqwvuoi2yq3ryest4aakgbr50grtmqxim
4risndludd7syajoqjfcgh0ervh4aiwkqr6awhbegxv8gdxgqraqareywapsaslkwury/0ze4ozk
yeavzmgtxumqumasmbouinytzilpwgka5cefxe3wfjcdcaea+jsf9gtvhy55gavzmlgf9miqhmcd
zamtumb+soi7mk8smmikgiiqrii/wea8qocyccgyemn9imhcpae9qaafrgsq0m1k+sgdjia3yeoy
abwvpaewkma1dimpijot1rqrkyyujknd3msg1itpmezmsf1nwyiuaecsmu3pwkawze4tkiefpejo
bqej+hsa5er22o15emzhgfs5kdgc6emilhayzem2jmaupmeuzmanmie9mmekoalfwgea7im/oijg
ponv6mlmpyapuia9zeubueeorioqpp9keqpkcvqrdfsfxrhizyadihrdpmwb1/ebmnyab0kbom0l
1p1da/bb083ljnxut/6b13glxieah2abbmpbhrxqpmwls0ututybifilwmjfa7mfv/arn8ybgdtd
pwqdclmatwgxpasbi2cabugik05afdydnaaamkaackddepwwivcamjjhc0hcknwdc6vww+ang1qa
embffkfczeqdkctbb/tbkxhaoycic8rddvxgemzlgwilhoplggda0pjsotgucu1wtzglbwycdede
ogcabswlh7hafoggct1bfqihwjdhjprrrszbcwsdcs/vfndcdqpwi2fadadagbgc+6h/wzogadoa
gzxkmzqwa8wqwxteg3ocukk5wo7evrhqac3ezcgsatmidn15qy8wchbowwcowaeswx/8ysvijime
omwqxe2yq+jijlu2bij+eb8spqwycjqxyyb8ydqyzx4gax/42x9ugc8u5xv8m9isgkbubcamqt0e
qzawqjwx7xrmnionqro07rhiit5aazrygz9m9t58ajqqqzuawqwmqib0qvyo1pd51y0owwhiqjrm
wzc81k55ax+sfhaaageqgsko1dwgazksdavuer5vbgb5kxuzrdxcrmy4hcfywb5ygl+15hmgttmr
0kbretf5rbruquztrszvhlb4bsb//wwzqiezbapbnna2mc/z3kaabfcacmivoee4aaa0imm+iam0
oejsq0m4hekoxiasheapaen0echdekh/nuot/im0ceq1vqnruiherdi1ceewvaewbenswuimjpmv
/ielseokgmav4kbeeahj9ighymaqvagercgmdapuwhmdaydpnuqqvayfrcmaubjvinnf7dlvgxya
hhihpfg26ofysginwbunoenq/ai07mmmoikeawm0qjjphmmjjii6tei9uamttaupnaitzacpomwi
iahl2a2majwd9iel5meleif098esuma2wiasiamstlmu9aiivuyfqfpqsefm+gkqlp8gazdcpkut
f7waolxcdordpwyqj8talogduedy1lcdivefnxsbgu4kwehechtacfadb5hzccyviq+wi8dzxkks
fbtabowdcutzpgadpmq2fwgaojipktgbnaryhuirmkhrsrwaaxrbvtf3yxgdmzzob9rclyabom7c
7svcpytavsszayabheljidoeunhbhqxdbdwbhfnsrm3ck/cbfmrbklgadiccflwcmmxohatcebyc
i+emabgcdya5v36iju0edzbbgtsdkah5nmcpikofispvepscn1gajl8ynkbdvy8bp7amfkzbeeyf
s20pe5gze4yaqoi4jbxhsprfwtz/gbvfhb8garwewisaab36aszaggyedjpvgthjqemybofrxdke
quykrkussexdg7j0qs8hqaqngdb4jp7chge8uk+rhy1yqrycqxo4abozga6imfy1+x4ywfdswthc
8wtyngqiawp4u+v4wzewqq9ggiocqhgngwk0qrc4laxuqsmmwxrugqkfbdrcayxegazaagkeabxo
wqcgwbmgke5moofasdd4okge/wnaihr41+niawgcgwhuliiiiwgm0b6kugf8wbmcdrawqzfx6l+k
itfkqr+sqdqkwxqenhuyqg9qw5wwdpvfwmozgtywqivsq21r8jn8wgrww7l5qzlg/watsmekcab0
wi+w7lytjmacyak8v0p+ca03zekqc0eqhlkaueiexenvnib0bueqkguiyu5mpei64apwy0av8efk
paebiikd8aegxemf8pkhaeivaib3awakgaiuuqamaaai9ueflaae8am/4me3aad3rqd6w0mhceky
pmmxueew9iapndsqkf4updycdwejfii1amq+ryimfmi3xg6zoy8wpdnhwfi8djjokguizisrjalo
ngg2i8quxdwouphgzrs8gdd6bifhwjmuxhyuajmxp5+viihqbynabk85apg0xhuspqpsecce7jhc
54kwplhq/ojlp0q8yj8m7mns5/9jhhignhcrkiueac388gzz8ajkoy1+8pblwy2bn7wpvobjq6+h
qtj/3gtlvoccbsyu0qrh8thdiwhooa0b5giyrhq+wllimqllizv+0ifw08tlqvmyrwxacmwbbzqh
rdkgkxcpvc0sxkzlcagboiwwlr5s4vojkahpnvyxyhapgr1bzpdzy0hljs01znytqethdyt5sgsr
ki8pcabpqmcrvsmlubog4qxdghj/efx49tkrwi8flcaxhz4ftgmgnmdccamxjtxpbdf33hhjmx2i
agyyysb4ia8mghghisbqcamedfbabbmojshaflpooscoyfl66jaq3imjg2b+kmh/ghxgeyimg3aj
aga+dcihlfpkwqecj+lpw6g+umgncbbqmeaclvyggbdezahihvzwewk9hatoowy55gnisi6qgcsi
j1waxqwhwgdaciqaoiigk/qkayg+pfcaimq8yukey3pygj5/ha3bjrawyyyxjqjjjgxqlhgkbxgs
ayybyjgwbqdqmocegn/quzsrenrg5a4ghltggy1oqiybkxbrhqpmqlilmi8quykebltygricaidg
irq40okjidxjamz14pgedwdkswipf7rhqozwa+kmgxln4umpemqjbp4+ipfgnq/8qaqs5olgios/
zgeaegbsaqinioyg4t8amgem/6+88dmggzowimpayoojjoqwke2masoyccoycxyzqjwaqiaihtyy
ccpug/6hzog2mmiag3gwkoeccxax5bmqvnkfjzf24yykxnwgyyci1rfbiyooiygxxnzzx4u99ngi
at32kkgljwyagds9gubscf4okwgebppxqqkulehxajkryoehfloxpob1dbkkglx3wcdvynt5msrm
uai66f5xnogmm9qaeief6gmbgmpcoftjbcipzylfgehhamkeseryu6l5yqgokegjmztosguogjr4
xxsqukgbhw/wolgxd3zpwrgraidhkymckaeeaaaivwktelakdxlq2kmglcrp5v8vgfioa51aapgb
prda4f6ocvdrakotsoajcd7y2eopp1g3pel4anaapz8nrqma/ahp8b+fjqnhgi1bwd+ccydylegw
lnpdp9xxjngawxevqeecskunll2aa5nygjwkwaqgjiirhejhclpwjcsyylex8dxt/kymtzqgfwsq
qlos9wq1iaiatakbflqbjhlaqwxmkceeukcb4cuef7iqwizaugupkaf4dyohf6iqj14yabiy4mmr
phapr8bgunxwqdve4gfdagtnhtiffryrgg6meaph4aa96eggybqwgaxyubhcaslwpgn8n7aebnca
a0izqgcyoam4wjegargjgat/xfuwzrcffpajrz+7hdb0wy0xdoujviadphbabxjm4g9bwiyupbe1
gztjxkhartlaecfmcoeafkibbqzaflk8yilykmijhoafiusjd3v4qc9rcmuhfmaeaacqbqavtcug
ax+4wkvcalgfy2bgcebygauwqi9gliaqpjbgmpoyghaugh6fwiafriecbrqienjyq+tcmaombmbm
tmggykjbj3pwyaotueavbjo/turfg9w4bq12qqq1acacbagtfkigboviihey6ey+ytehlrwjeoyi
ii5coms+8oecwshcu7jwhwtuyikggaox1sqhkxygg1jazj4myaaupcecseot/y50yyevdg6bj9km
onqwha1wyakpq8ak0reeezjdhm0gbchooqjzokkobijdi4jbbw7w4wztymmqugzbd4yiganwrxjc
mlf/nc6h/jbccwyhkj2nhazoqeaksrcesbhnfgrygnoeqikg9emkf2do0/jgr6k6yvl++fbenrih
lwshhfedqt768yoiuakg85ebclxnb6bxa1d8ook2uyc4fadcem3gqa/quy811mmnbnbhcberdmg0
4mfxmmy0nhchohdggiuo5zc8uaj5xgenyewng5gwbuux7b+mmav2nyacb4tdckrdhwzsqaw7lmqk
swjsevggd1xg9bajgguuyv8bgl+awgvweov6flgocmhbak9yjvcava4p7aeexmccc/qac+un9a8u
rfaftfabvpwsalutxshymocjdhcia2ceqcxghi5koatp6eixdoqbrfi4qnewqhs20azromirrwdl
guyhkgugghphqnicqncherdhqk1yxdc8yqd/ikqk78avsgyrlq/ayd3saecg85ydasajcalgvpnk
qqqplamx6geaf7jgpagshwuzmaxfnpaegcdgd1yix/qqaiaa7mbks+md7x7g4lyfrhbeqeah6kqp
irqgdwyygrnsyy8m2gme9kjdfezqgdx8cqurwbxa48gokwskhxvortmev7h/kbutae68wz/ycixj
neeyjtclbv7marrc4hyjidz42ogbofrbs1xgxrny8n9yrimxqqhibiznyibukshg2aeufl0exswc
bi5ibsludabdteczfkhcc+lhlt6w4wmi0iuudnewmofib0foahma04eu2kmlughce3jag1m34rqj
uig9msajawj5hokaryyksif/mimfx4hdcyobskglnxr3dmyc1cqcskj0dknwbg14nztcvfekwgab
elgxxj2ugxe4apqtnbbnx+aqff8kgihuth4zvaigwohgn4anhbpgqqneqqimyfskizufw0u5rwwi
frcg6qukef91y7pq4x1x/9zippacdzdshaxkonsyymiw2hapokzccueoamq9sywrssechujuircy
jpua+wypyivo7jbuxvfsnnqzcxz0ugdfwc9vf4iaerixnxmugehecpmunsg3mkjfckpwun2gmwsx
goaa6olgvzyrihmsoayyqaiisceuc8rgdychaob0xg1qzgie2wdmf/srbohpho+iqlgxvkam82fc
hqdggjbaoqvhzyefi/egd1toaxiygwmtq2ub4ncmjrxdchrhlyyaceacdezag/4aapzgkhtha2ta
f/ygb+bbljkgh/5akkxactbbakcahzic3dij7ecad7hg2wagcpaafixkhv/4ga+64feyogxnyg8i
qnhicyqoyoxkaiv8oataq9uaozekwdtgtxrooolezwto4aqwthlowrnsoaaswqxeib4ewbuy6mam
gmhmwrykqx7ugi4w4lpm4rjkwqekih/gybuq4gc+lyqqamhyhiiuqqzgqrhi5nsaoaskgahgwqua
4e7yp33wraqibxqibwwd4g/2ib6slwhya0zgiv/2ib+wgeiiaas2orzioqsqaq98zjyqpggeqb9y
lmemgdhkiwivifyo0ateqfyo8ars4wmbonwkarzi4qx8iueywxa2oa+eyqmcaruaarkjyrqk6xge
wqtucfd4gqa8wqj6hlf/qmemqsaq4uepss/9jutq7cdchiwxuksmkcebhoixiejnwoadgaiessa6
qmcwwkcd1kekeieunmadosmf+yaiugejysewfdc+mippmo2t/edugancppafjkejzcejrqeqjlaw
mbiwlwiemm4kqkea2kafygekfksdhmab+gelrkazjgadnmarbczxraekdq4kemuxvoekxsabgiab
rkbvroaj8oujjgb61kmbyc8izoeecwdofcer2edd2uew1kyz1aue2abgskacqsmb+iwro4mlugel
9uavpaaazif2maoiuogf/kd7hemkgwei6pijmi4dku4eaoeit0ajnxli/9jvcqygg+lafzoghozh
daqkunbadl7bgd7bgizhgyrgaxxsfyqgrntbv2shgajqxibhkkqankoi39bsw0qgj54aehomhlkh
g57af7ohcyygsyruzzgctdqlhszss7jaa5jphrxipjycltomtkhhhv4mahshtzdjd3qbdgragpig
agksb3pag0ota5raly8yi0/afzxg4psqbzlgfghhmepadm7bcfrbfo6oqaihuprsghdamjraggqs
h5jhvnrodpykoj4jbprgd/oabdtaaezk/qsxaudblcdhzyjaa1+hawbrsapm6ljaz0daanaub/ya
c+shg4tikiukd+ybwf/q5jxqdat1aqgqafa8gb/ayq2gggvwyajyoaesiwo8d9uywc+dycmykjyb
qbb3jkxs07wkmw6wdmsahw3+gy4aqrmts70wyrkyivfsaa/sggey8anyyqfqbt10aasa4amboars
ydlmar6a5e6ohwgsiqlzjwu1a0wnoerqpj7iisnsis2apqok0mg6ybbuqwss4anq7pmaoarktai8
4agoibzq4eowievpiq4wzh5stbb9uhzdivrxkfzmr/xuw7z2agmaxxregidyqfbdwbwiyrrklq2k
oq2ggbk6cexcylz+yt2qaf16e8eeyef3ae/2rvtigugklg8a4a+2irh/meomejq54rfqjxiauis+
qaafskakioxzeqepssarhpuqxqsesgaiyadxace++mastgedgueimkeuhmartohujmh7llau5obu
nyjuluewtmekzmeize8zrmak0kafemadfkuhbnqnccc56khy2oc42maspeeehmaofg9hqmc2pmn3
niapsqbu9gbrz8gpsux2flaj8uzoyiqafkefagbnagkotcvv2meoywcf8ieonaqpaaacdemniaia
jqacmpijmmswiaeiukadfgkjhistptumhiaypkasfhywusmjxceesdvjmcielojulyiktyeahmsu
okyqqofkxeub3gan/6qhzm8acrihaiogagydblqaev5ultamhwbgso4ffpycbhl2d2yjz9vsao4c
h7gghn6boai1b/aheosubozifziutb7askokwsy0swxbzwcagflbf2bm2bbbhrtbhsiaglzmmlop
1qavi0xbbezv/dcc/i7winjahqzgdwugdjflvcreqk5fqjswedzgc84ad3kecrdpa7caf64ghpgi
xz4alklvbwbbtx1mw4shsj6a6tsczcf1kyzicvpgkaqhpoacq4cilqo0pry0b4tictrqavvgawdg
ayyhd8bbhhzhcdgbrwuagbio1sa21cpobdk2vmlpfsip/hhghjwb4/8ilj4l4y6sc0qswzgyagdp
nsbwya0eirn4ixxwwwrwiquaqt0+lcnqdqcqgrlbrwpzpqzc195+4umywp2qvns1byrzfoaovasa
tcjgwyuyofqtobvuwwrwybyeilbkywy4jtopkgsema1sjegqkbwktkh5gam8qbjikqdgkfycsbni
wg/zfkryut3tqrjkeejitbou4bimgrg+cqo1aif6iby44onyqvilyiellx2uqfir1pkjnwd/4xqb
tlihgh4fzcjwhcgcjfq5acoa7ccyym30qd12wapgoarw4awxwahaos7doqc4wa0cuhxnywximw0n
vvzswqvsqs9fgfz/msalziecoegtwbhlgo4gilcqaxykoifl/lyahsgk8sykajkxlpkx4khr1omp
gmabgslagrgk6kniookt8wye7oy+fqefwkb6vblvlklnjcitvkhu+ib1mmj8jjadusfibcrxbis8
+spxhmpv1hmkukcz01yu1fbvag+ei7eap1usgoeqwk6vkab6us3vao957yej6ihgysws0oe5erhj
jmpol491dkebw2acyiqdphdmjqlsaoctm+qjyuep6k0ep9gqlnkqnnqn2dslgkakhmeqhlepykbu
aiagioerjyedfslgwrd/cobsbrmxnbkjy/gjprmp89gljpchatf5/7u5eajbdulbhbpzerkv1bb2
bgsh1cshlpmrxtlbamqzewrjfoq1hsoct+yxbrvwpdbythk4n7vghbmykp4admmeddjixraqf9xd
fr7bwdmbhasedxp0d3zac+qbjeubhdjgrv2wderhuhrdfc2a4pkwimmxgbzg78jpbpr67+ybe5hg
rprpbpiafkrtbc/vfeqtuxn5cht0dnijbsbukdtrbp4jw5ljpvh56yridxi1wbj3pzjakjoelir1
n5dcwxs1bmapkuhqxgug7iji2coacyk7udwwrwuqykcgl/fo7/ayrk86lzoy4j51vkwhzbp5u1fd
/bj2fgqha8b7cb+kyqua4gozg3hwwyndjwqroijyqz3ktqd/lmscicaaads=
------=_nextpart_000_001f_01bf1b8e.2b295be0
content-type: image/jpeg;
name="fourstars.jpg"
content-transfer-encoding: base64
content-location: http://www.stompandstammer.com/fourstars.jpg
/9j/4aaqskzjrgabageasabiaad/7qzcughvdg9zag9widmumaa4qklna+kaaaaaahgaawaaaega
saaaaaac2aio/+h/4gl5akydrwuoa/waagaaaegasaaaaaac2aioaaeaaabkaaaaaqadawmaaaab
jw8aaqabaaaaaaaaaaaaaaaayagagqgqaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa4
qklna+0aaaaaabaasaaaaaeaaqbiaaaaaqaboejjtqpzaaaaaaaiaaaaaaaaaaa4qklnbaoaaaaa
aaeaadhcsu0neaaaaaaacgabaaaaaaaaaai4qklna/qaaaaaabianqaaaaealqaaaayaaaaaaae4
qklna/caaaaaabwaap////////////////////////////8d6aaaoejjtqqiaaaaaaaqaaaaaqaa
akaaaajaaaaaadhcsu0ecqaaaaae8gaaaaeaaacaaaaacwaaayaaabcaaaae1gayaah/2p/gabbk
rklgaaecaqbiaegaap/+acdgawxlihdyaxr0zw4gynkgqwrvymugughvdg9zag9wqca0ljaa/+4a
dkfkb2jlagsaaaaaaf/baiqadagicakidakjdbelcgsrfq8mda8vgbmtfrmtgbemdawmdawrdawm
dawmdawmdawmdawmdawmdawmdawmdawmdaencwsndg0qdg4qfa4odhqudg4odhqrdawmdawreqwm
dawmdbemdawmdawmdawmdawmdawmdawmdawmdawmdawm/8aaeqgacwcaaweiaairaqmraf/daaqa
cp/eat8aaaefaqebaqebaaaaaaaaaamaaqiebqyhcakkcweaaqubaqebaqeaaaaaaaaaaqacawqf
bgcicqoleaabbaedagqcbqcgcaudddmbaairawqhejefqvfheyjxgtigfjghsuijjbvswwiznhkc
0umhjzjt8ohxy3m1fqkygyzek1rkrckjddyx0lxizfkzhmptdepzrieupiw0lctu5psltcxv5fvw
znaglqa2xtbm9jdhv2d3h5ent8fx5/craaicaqiebamebqyhbwyfnqeaaheditesbefryxeiewuy
gzeuobfci8fs0fazjglhcoksq1mvy3m08sugfqkygwcmnclsrjnuoxdkrvu2dgxi8roew9n14/ng
lksftjxe1ot0pbxf1ex1vmz2hpamtsbw5vynn0dxz3ehl6e3x//aaawdaqaceqmrad8az+k/4w/8
yxwch2n04ytt7gg0sc2ur2nlwodvylamfssz7vozx1l/xs4mnblzfogyjhyblxb+m4hjrlvyzkc9
/wdvyvkzwk36q/hz8klpo+d/aizfrxf0nqmzzzr6uekdvfq2/plfsfu937qzf/he+ui/px/+2r/5
jy3sf/e317n6glz/aogfhd0lpbf+o/8axh9/h/7zh/kle6h/js+tenidlurfrvzmv1101d6qyczf
9uvtb6onsvo1q9z/5o6f/wceh/8at91jjt0p/jv/afx/fx/+2r/5jwonf41/rdldqxcax9gy+6ut
0vcyc9rhr7vnccrvrp8alra/8m0/+fgjkey6l/jw+t+j1dkxmwuflf1lbzqewx7mnn3kt/47/wbc
f38f/tkf+sxmdb/5zz//aa1f/wcfhkikp9p+q3+mt60dazlcxiuqreubj66my03zubgpf79zxbam
y3au+hsprjh/ac+7/wbhkp7l4z9rd/27i9ld6mzf2+ls9td+0+lbft+0fq/q/wcj9b9d/pv6sp8a
nfh/ahu//cnjtofsj6yf+x7v/ysj+5znt8j6x5/ucvpg6r6x7plgchunuxwzy9rpua79gz0q2bp0
bpeif9kx/m+/+eax+lftb9rzno/td1/f9o+z/s37tpqv2fbptn6h9h/ys/p/akr+ksuv1t62p6bm
mwn/afgvuu+0/zcknwa30ydy67xgezl2vzwz0cd+/wds+tx9bavmt1g/v3j69g9edluuy999tx4b
kg444s9j2wmzcz9jt6bvz/uvpq//adh39pn9o/0yuptv7en6fv8aydh/ahpf6dd/gvxuuvft79hd
t9x9s+n9kv3+v+x/sj0n7vth2b9y9l/seh+l2fzasn//2thcsu0ebgaaaaaabwabaqeaaqea//4a
j0zpbgugd3jpdhrlbibiesbbzg9izsbqag90b3nob3coidqumad/7gahqwrvymuaziaaaaaaawaq
awabagaaaaaaaaaaaaaaap/baemadagicakidakjdbelcgsrfq8mda8vgbmtfrmtgbemdawmdawr
dawmdawmdawmdawmdawmdawmdawmdawmdawmdp/caasiaa0alqebeqd/xab1aaadaqeaaaaaaaaa
aaaaaaaabaugbxaaaqqbawqdaqaaaaaaaaaabgadbauuiqcxeai1fgevnicraaecbambcgolaaaa
aaaaaaidbaabehmifaurmimzkzsu1bu11rbcumjyq2nzdkqhgooz00s0rqywnv/aaagbaqeaaabb
+cyiopdqrrtotgj9hgn7ovssrkk0o6b0yzjsdr//2gaiaqeaaquaibugk1/37dnpbxf0d673bjk+
55qklzuvk23bjiermoqxnrup27zjfi81fs5qkkigbgttyxssypt9osmxm6ba1qosexesope/zavf
22d/u1mzcos/u9cxyps58dotftd3zuxrjklklkmo3pyxxsnuek1ec++rexf/2gaiaqebbj8abu00
9o4xpbqkkiuzltks6abyrfsgop8aofjo/waadrwzmk1eymcggksjcqzpitcbrcyw+yitmrjthkyc
zgcsymkzkkmzocindi+thjwhfrdkjkrdi1ulqmik3zkjtmq85kcs51og6dxswfyoavfzt+zhjwhf
rdkjkrdi1ulrpy6bdnmnryl1jecuyrc4ds6u9jkcftqh145kw4tbpuclycwt0qe9k2bru5upku0f
vrpby02iqpzxesxwslz3vetwr2iw5it3rhaldmk3esjapnwznveaewcsbkyervs1vdqsb58yukrs
eqdzcfdhady65plo7tt5hsavvo7ou6sfvnqwgoz1rtacoa6gkrupozutorvng1hq9yld9zvkn2gd
ytm4brr3mmr9fg2qvfvrlfxnflww/phlqi/n8vnk13tyvdqxv3bv10+rj99+bhbo3m3wv+9tu3kt
9vxn8vv8jxvkaz8e5+9u8kpwgnfowfh0l4btzz3ufchpt0kl1qtrlmf1srgnzovrxe0helcylx2k
dnsofld1r2cw58t3vdc1gryxsptjjii5oauxsfylebnjaqn6zblfpthd+w6dopj5bpvvqvwm1pxu
rlhs4y9t6fpof32zmnwdzbpw5dsaxd4k5rr+thjobfljatj5qgcvpmf3trpep1dhistuhax+zt75
/9k=
------=_nextpart_000_001f_01bf1b8e.2b295be0--
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 22 oct 1999 00:10:04 +1000
reply-to: anne maynes <n1910493@sparrow.qut.edu.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: anne maynes <n1910493@sparrow.qut.edu.au>
subject: re: lesbian movies
mime-version: 1.0
content-type: text/plain; charset=us-ascii
>>that's why i love "everything relative", the characters and situations
>>are
>>very real, although somewhat dated.
i really enjoyed everything relative and the actress playing the character
josie sounds alot like emily. even cowgirls get the blues was good and i
enjoyed k.d's soundtrack to that one.
"when the winds blow things round and back again,
what was once your pain wil be your home"
-emily saliers
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 10:43:19 -0400
reply-to: ron mcbay <usul@mindspring.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: ron mcbay <usul@mindspring.com>
subject: nigc: gay films
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
no one has mentioned the movies of pedro almodovar. many of his films have gay
(male) content. the best of those is "la ley del deseo (law of desire)"
starring antonio banderas. his first film, "pepi, luci & bom", contains the
most disgusting moment i think i've ever seen on film. it involves two women in
a sexual situation, but i wouldn't actually call it lesbian sex. almodovar came
to atlanta just before the olympics in '96 to introduce his (then) new film, "la
flor de mi secreto (the flower of my secret)". in the q&a session afterward, he
said that when he first tried to get "pepi, luci & bom" shown at the local
theater in his hometown in spain, not only did the theatre owner refuse to show
it but almodovar actually got thrown out of town.
some german films worth seeing: "maybe ... maybe not" is a pretty mainstream
comedy. "killer condoms" is pretty funny. it's not particularly about being
gay, but the protagonist is a gay male police detective. "echte kerle (regular
guys)" is probably the best film i've seen exploring the nature of
(homo)sexuality. it's about a straight (male) cop and a gay (male) crime
suspect who (sort of) fall in love.
don't get me started about "the object of my affection". ugh.
ron
--
ron mcbay | i'm headed down to georgia
usul@mindspring.com | so don't lose track
www.mindspring.com/~usul | of where you've been and where you're going,
/hoops.html | who you've seen and what they lack,
/billy-bragg.html | and why you come undone.
/view.html | -- "sister", amy ray (indigo girls)
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 10:16:58 edt
reply-to: subcityii@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: subcityii@aol.com
subject: billboard review
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 8bit
this review is from billboard magazine:
those who have pegged ig partners amy ray and
emily saliers as little more than earnest folkies need
to lend an open-minded ear to their seventh studio
set-which shows 'em at their most varied and
creatively potent. complementing their signature
acoustic strumming is an array of well-crafted roots
rockers framed by adept, intricate electric guitar work.
ray's superior contributions brim with guttural
intensity and wildly emotional performances, in which she often
sounds two steps away from a nervous breakdown.
most notable is her blues-kissed "sister," wherein she
vamps like the revered rock goddess she deserves to
be. meanwhile, saliers seasons her reliably sensitive,
introverted compositions with newly discovered
aggression-as evidenced on the foot-stompin'
"trouble." added pleasure is derived from guest
appearances by sheryl crow, joan osborne, and
meshell ndegéocello, although their appearances are
more incidental than integral to the set's overall
appeal.
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 14:55:50 gmt
reply-to: jen meklenburg <jenmek@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jen meklenburg <jenmek@hotmail.com>
subject: cons review in the "houston voice"...our local gay paper
mime-version: 1.0
content-type: text/plain; format=flowed
love & trouble
indigo girls offer a broad call to action on new cd
by laura brown
"come on now social," the title of indigo girls' new cd out now, "beckons
you to all things being social, and to take part in relationships, but it is
not something that is specific, that you can say 'this title means exactly
this,'" explains emily saliers, one half of the grammy award-winning duo.
the title comes from a song by musical partner amy ray not included on the
new album. while both ray and saliers have become outspoken activists,
saliers said "come on now social" is "not specifically" a call to social
action. "it's a call to whatever it calls you to," she says.
whatever its individual meaning, "come on now social" offers listeners an
invitation into an album both intensely personal and political, wrapped in a
musical package more diverse than any indigo girls' offering to date.
co-produced by john reynolds, a drummer who backed sinead o'connor on tour
in 1997 and 1998, the cd features special guests including joan osborne,
sheryl crow, me'shell ndegeocello, and luscious jackson's kate schellenbach.
"come on now social," the duo's seventh full-length epic records album,
shows saliers and ray continuing to reach beyond the musical formula that
has won them legions of devoted fans around the world.
>from 1989, when indigo girls' first album was released, the two have become
known for an intelligent acoustic sound, with ray's songs more rock-driven,
saliers' more introspective.
but this time out, it's ray who offers the album's purest folk songs,
evoking traditional mountain music and even bluegrass through banjo and
mandolin on "ozilline," which features a voice-over from ozilline walker,
ray's grandmother, and "gone again," a catchy feel-good tune with lyrics
that will put a smile on the face of every fan who can't seem to quit
falling in love. ray's edgier side still comes through on songs like "faye
tucker," a celtic-influenced response to the first woman executed in texas
since the civil war, and "go," an electric guitar-backed call to action that
opens the cd.
"i think it's a natural progression. it doesn't feel like going out on a
limb, although, i feel it is the best record we've made," says saliers, who
shakes off her own folksy demeanor for "trouble," one of the most driving
tracks on "come on now social."
"a song like 'trouble' is probably the rockiest song i've ever written," she
says. "i love rock music; i've just never been able to express myself as
easily in a rock format as i have in ballad format, unless i'm playing
electric guitar. so 'trouble' is a good release for me."
"trouble" breaks ground for saliers thematically as well musically. while
"it's alright" a track from indigo girls' last cd, 1997's "shaming of the
sun" shows saliers speaking to people who "hate me 'cause i'm gay,"
"trouble" goes much further, addressing specific gay rights issues. with
backing vocals from joan osborne, saliers takes on anti-gay religious
bigotry: "and when the clergy take a vote/all the gays will pay again/'cause
there's more than one kind of criminal white collar" and looks toward the
day when "a girl can get a wife."
"at some point, you've just got to say it," saliers says of the duo's
evolving outspokenness on gay rights issues. "it's such a part of our lives
and there is still so much oppression where people are trying to deny gay
people of just basic civil rights. ...it wasn't like when i set down to write
that song, i decided i'm going to make a 'statement song,' and i'm going to
talk about homosexuality and this and that and all the others," she
continues.
"it's just that when i got into the song emotionally, i started thinking
that one thing that really pisses me off is that the church that is supposed
to represent the teachings of jesus christ, who never said a word about
homosexuals and whose teachings are about equality and loving each other,
and doing unto others, and you have the institution of the church preventing
homosexuals from becoming ministers to help and love people.
"it's just a perversion of the teachings to me, and so that makes me upset,"
saliers says. "so when i'm writing the song, i get all worked up and i'm
like, wait a minute, i feel this, too. and another thing like that."
another thing that upsets saliers on "trouble" is the lack of respect for
gay and lesbian relationships, the fact that a girl can't "get a wife."
"i think gay people who make a commitment to each other and covenant ...is the
same thing as a straight marriage, but it is important to get the legal
protection and recognition," says saliers, who describes her own partner of
five years as "awesome." "this is not just a feel good, symbolic issue."
listen beyond the last track on "come on now social," and the same themes
surface again in a simple but hauntingly beautiful song about "the
philosophy of loss" that floats at the end of the album.
"modern scribes write and jesus cries, and everyone is free/and the doors
open wide to all straight men and women/but they are not open to me,"
saliers sings.
being so open may have cost indigo girls support from the music industry
along the way, saliers acknowledges.
"i think it probably does hurt us in some ways, and turns some people off,
and there is some homophobia in the business," she says. "but we have a
great career, and we have great fans, both straight and gay, men and women,
young people and older people.
"so even though maybe being so socially active and political may have held
us back in some ways, it's just really the only way we know how to live, and
i would like to thank the fans who stick with us. it all gets so serious
sometimes, but a lot of it is also just to have a good time."
while the cd still includes plenty of songs focused on love and the simple
joy of family and friends, saliers cites "injustice and love" as the two
most common themes for her songs. will indigo girls one day reach a point
where they leave behind the music to become full-time activists?
"i don't want to do that. i think that you can do both, and i don't want our
music to just be purely activist music," saliers says. "because i think
that's limited, and these are such catchwords 'activism' and 'politics.'
they mean different things to different people. to me it is just all about
love, about trying to spread love in a broken world."
sailiers said, "we still love playing together, we love this record, and we
love our new band, and we love each other."
indigo girls' next path will take them on tour around the u.s. this fall.
peace and pride,
- jen mek
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 11:11:37 -0400
reply-to: susan brill <susan.brill@yale.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: susan brill <susan.brill@yale.edu>
subject: re: queer movies/philosophy of loss
x-to: andi lipman <ablipman@sas.upenn.edu>
in-reply-to: <3.0.5.32.19991020212247.0088b100@postoffice.sas.upenn.edu>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
>
>and for some igc, does anyone know if emily is playing piano on philosophy
>of loss on the cd? when she played it live, did she play keyboards?
no - when she played it live in ny she played guitar. she had the band
backing her up. (it sounded great!)
whether she wrote it on piano i do not know, but that sounds like another
great question for the woman who may be doing the ig interview.
-sue
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 15:10:14 gmt
reply-to: jen meklenburg <jenmek@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jen meklenburg <jenmek@hotmail.com>
subject: mp3 files
mime-version: 1.0
content-type: text/plain; format=flowed
hey y'all. maybe i'm not getting this right, but what's the deal with
searching the web for mp3 files? i use realjukebox (the free version) and i
make my own. well, they are realjukebox files, but it's the same thing.
peace and pride,
- jen mek
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 11:09:44 edt
reply-to: dresden5@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: no name <dresden5@aol.com>
subject: three finger cowboy cd for sale...
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i have a three finger cowboy cd that i am ready to part with. its a promo
copy of "hooray for love"
3fc is a daemon band, and good... just not really my style.
its up for whoever wants it, i was thinking $5-7 sounded fair, plus $1 or so
for shipping. of course you could always win me over with an exciting trade
or something... its been years since i dabbled to boot/trade scene.
let me know. the most exciting offer wins, and i will decide sometime tmw.
have an exciting day.
kate rw
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 08:17:16 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: re: cons review in the "houston voice"
mime-version: 1.0
content-type: text/plain; charset=us-ascii
the writer of this review says:
>>"modern scribes write and jesus cries, and everyone is free/and the
doors open wide to all straight men and women/but they are not open to
me," saliers sings.<<
are these the right lyrics? i heard it "modern scribes write in jesus
christ everyone is free..."
anyone know?
jean
--- jen meklenburg <jenmek@hotmail.com> wrote:
> love & trouble
>
> indigo girls offer a broad call to action on new cd
>
> by laura brown
> "come on now social," the title of indigo girls' new cd out now,
> "beckons
> you to all things being social, and to take part in relationships,
> but it is
> not something that is specific, that you can say 'this title means
> exactly
> this,'" explains emily saliers, one half of the grammy award-winning
> duo.
>
> the title comes from a song by musical partner amy ray not included
> on the
> new album. while both ray and saliers have become outspoken
> activists,
> saliers said "come on now social" is "not specifically" a call to
> social
> action. "it's a call to whatever it calls you to," she says.
>
> whatever its individual meaning, "come on now social" offers
> listeners an
> invitation into an album both intensely personal and political,
> wrapped in a
> musical package more diverse than any indigo girls' offering to date.
>
> co-produced by john reynolds, a drummer who backed sinead o'connor on
> tour
> in 1997 and 1998, the cd features special guests including joan
> osborne,
> sheryl crow, me'shell ndegeocello, and luscious jackson's kate
> schellenbach.
>
> "come on now social," the duo's seventh full-length epic records
> album,
> shows saliers and ray continuing to reach beyond the musical formula
> that
> has won them legions of devoted fans around the world.
>
> from 1989, when indigo girls' first album was released, the two have
> become
> known for an intelligent acoustic sound, with ray's songs more
> rock-driven,
> saliers' more introspective.
>
> but this time out, it's ray who offers the album's purest folk songs,
> evoking traditional mountain music and even bluegrass through banjo
> and
> mandolin on "ozilline," which features a voice-over from ozilline
> walker,
> ray's grandmother, and "gone again," a catchy feel-good tune with
> lyrics
> that will put a smile on the face of every fan who can't seem to quit
> falling in love. ray's edgier side still comes through on songs like
> "faye
> tucker," a celtic-influenced response to the first woman executed in
> texas
> since the civil war, and "go," an electric guitar-backed call to
> action that
> opens the cd.
>
> "i think it's a natural progression. it doesn't feel like going out
> on a
> limb, although, i feel it is the best record we've made," says
> saliers, who
> shakes off her own folksy demeanor for "trouble," one of the most
> driving
> tracks on "come on now social."
>
> "a song like 'trouble' is probably the rockiest song i've ever
> written," she
> says. "i love rock music; i've just never been able to express myself
> as
> easily in a rock format as i have in ballad format, unless i'm
> playing
> electric guitar. so 'trouble' is a good release for me."
>
> "trouble" breaks ground for saliers thematically as well musically.
> while
> "it's alright" a track from indigo girls' last cd, 1997's "shaming of
> the
> sun" shows saliers speaking to people who "hate me 'cause i'm gay,"
> "trouble" goes much further, addressing specific gay rights issues.
> with
> backing vocals from joan osborne, saliers takes on anti-gay religious
> bigotry: "and when the clergy take a vote/all the gays will pay
> again/'cause
> there's more than one kind of criminal white collar" and looks toward
> the
> day when "a girl can get a wife."
>
> "at some point, you've just got to say it," saliers says of the duo's
> evolving outspokenness on gay rights issues. "it's such a part of our
> lives
> and there is still so much oppression where people are trying to deny
> gay
> people of just basic civil rights. ...it wasn't like when i set down to
> write
> that song, i decided i'm going to make a 'statement song,' and i'm
> going to
> talk about homosexuality and this and that and all the others," she
> continues.
>
> "it's just that when i got into the song emotionally, i started
> thinking
> that one thing that really pisses me off is that the church that is
> supposed
> to represent the teachings of jesus christ, who never said a word
> about
> homosexuals and whose teachings are about equality and loving each
> other,
> and doing unto others, and you have the institution of the church
> preventing
> homosexuals from becoming ministers to help and love people.
>
> "it's just a perversion of the teachings to me, and so that makes me
> upset,"
> saliers says. "so when i'm writing the song, i get all worked up and
> i'm
> like, wait a minute, i feel this, too. and another thing like that."
>
> another thing that upsets saliers on "trouble" is the lack of respect
> for
> gay and lesbian relationships, the fact that a girl can't "get a
> wife."
>
> "i think gay people who make a commitment to each other and covenant
> ...is the
> same thing as a straight marriage, but it is important to get the
> legal
> protection and recognition," says saliers, who describes her own
> partner of
> five years as "awesome." "this is not just a feel good, symbolic
> issue."
>
> listen beyond the last track on "come on now social," and the same
> themes
> surface again in a simple but hauntingly beautiful song about "the
> philosophy of loss" that floats at the end of the album.
>
> "modern scribes write and jesus cries, and everyone is free/and the
> doors
> open wide to all straight men and women/but they are not open to me,"
> saliers sings.
>
> being so open may have cost indigo girls support from the music
> industry
> along the way, saliers acknowledges.
>
> "i think it probably does hurt us in some ways, and turns some people
> off,
> and there is some homophobia in the business," she says. "but we have
> a
> great career, and we have great fans, both straight and gay, men and
> women,
> young people and older people.
>
> "so even though maybe being so socially active and political may have
> held
> us back in some ways, it's just really the only way we know how to
> live, and
> i would like to thank the fans who stick with us. it all gets so
> serious
> sometimes, but a lot of it is also just to have a good time."
>
> while the cd still includes plenty of songs focused on love and the
> simple
> joy of family and friends, saliers cites "injustice and love" as the
> two
> most common themes for her songs. will indigo girls one day reach a
> point
> where they leave behind the music to become full-time activists?
>
> "i don't want to do that. i think that you can do both, and i don't
> want our
> music to just be purely activist music," saliers says. "because i
> think
> that's limited, and these are such catchwords 'activism' and
> 'politics.'
> they mean different things to different people. to me it is just all
> about
> love, about trying to spread love in a broken world."
>
> sailiers said, "we still love playing together, we love this record,
> and we
> love our new band, and we love each other."
>
> indigo girls' next path will take them on tour around the u.s. this
> fall.
>
>
> peace and pride,
> - jen mek
>
> ______________________________________________________
> get your private, free email at http://www.hotmail.com
>
> --
> please do not send long non-indigo girls-related forwards to the
> list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
>
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 10:28:34 -0500
reply-to: "hartley, diane" <dhartley@winstar.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "hartley, diane" <dhartley@winstar.com>
subject: dallas concert
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
does anyone who has purchased tickets to the dallas concert know who the
radio station is that is sponsoring it? it should be on the tickets or on
the ticket envelope. thanks for the help!
thank you,
diane l. hartley
general manager
winstar professional services
office: (214) 571-6068
cell: (214) 837-6851
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 10:11:24 -0400
reply-to: catherine spinale <catherine.spinale@pmn.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: catherine spinale <catherine.spinale@pmn.com>
subject: fwd: mix lounge - 10/6/99 - soooo sorry for being late
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
____________________forward header_____________________
subject: mix lounge - 10/6/99 - soooo sorry for being late
author: catherine spinale
date: 10/21/99 9:58 am
hi everyone:
please except my apologies for not posting this earlier. i don't know
if you remember, but i was the one who posted the message about
getting a ride to amhearst. i got a couple of messages - but it was too
late and i've been reeeeally depressed ever since. but i promised i
would tell y'all about it so here is what i remember:
first of all, i missed the interview that was broadcasted at 5:00 because
it was done in the studio, not the lounge and stupid me, i forgot to put
it on while driving to lowell that night.
the performance started at about 4:00. it was supposed to be at 2:00 but
the girls had to take a cab from lowell and the cab got lost in boston. (how
awful) anyway,when the finally got there, they were rushed into the lounge
first for a quick sound check, then to the studio for the interview, then back
to the lounge. when they came in, emily said something like, thanks for
waiting, we were "site seeing" in boston, via towne taxi (lowell cab)
greg daniels, dj interviewed them. he started talking about the new album and
all the artists who were on it. amy named them and said they were excited to
have
a new band with them. greg mentioned how many albums they have sold so far
(i forget the number) and amy said "that's nothing, ricky martin has sold
another
15m today, and emily said, "oh, he is so cute" and she mentioned how she liked
his music as well as marc anthony. i can't remember everything, but the just
chatted
a little first then they did peace tonight (naturally).
then greg asked them how long they had been friends, they said 25 years. greg
asked
if they had any secrets about each other and amy said "we have no secrets, they
(meaning
fans) know everything about us". he asked if they ever fight and emily said
something like "no, we havn't had a fight in a really long time, we just know
eachother so well, and we give eachother lot's
of space, we don't hang out together when we're off or when we're on tour (i
noticed that in newport,
they were never together). amy then did go accoustically (it was so awesome)
after it was over,
she kinda staggered a little and said "oh, now i need a nap after that one"
after that greg, said they would take a reguest. guess what it was, yup,
galileo! well, the
audience took the song over completely and greg said he had never seen anything
like it
in all his experience at the mixlounge. amy said, "you don't even need us (yes
we do), all
you need is our picture up there and you can do the rest". then greg thanked
them for coming
and they packed up and left. they couldn't sign autographs because they were
really late but
it such a thrill just being there that it didn't really matter.
that's all i remember - hope this helps.
cathy
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 12:10:17 edt
reply-to: lyndsay agans <eccemus@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lyndsay agans <eccemus@hotmail.com>
subject: window cling info...
mime-version: 1.0
content-type: text/plain; format=flowed
hey y'all...
here's the deal, if you are interested in the clings: send me a self
addressed stamped envelope (a big one so they don't get messed up...the
length varies but max is about 8 inches.
cling prices run:
1 for $3
2 for $5
5 for $10
my address:
lyndsay agans
towson u
unit #38
8000 york road
towson, md 21252
cash or check is cool. remember to include a note saying which clings you
want (please include text and not just number)
incidentally, i've decided against offering my t-shirts to the list, because
of legal reasons, i'm thinking they'll just have to stay in my closet.
thanks...
hope you like 'em!
-lyndsay
(remember, i'm a college student and there are a lot of requests, so give it
a little time before you bite the postal carrier for not bringing you your
clings.)
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 12:21:59 edt
reply-to: gitroop@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "<erin tripp>" <gitroop@aol.com>
subject: "in jesus christ"/"and jesus cries"
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
though it says "and jesus cries" in the lyrics (from reviews), i think a "t"
is pronounced at the end of the word.. still makes me thing she's saying "in
jesus christ.." well, i like it better that way anyways :)
make you own lyrics!
peace-
trooper
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 22 oct 1999 02:24:12 +1000
reply-to: madonna maynes <m.maynes@student.qut.edu.au>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: madonna maynes <m.maynes@student.qut.edu.au>
subject: nigc: gay movies
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hi everyone,
radha mitchell from high art is in another lesbian movie called "love and
other catastrophes" which is a fun australian film.
the second "if these walls could talk" looks like it will be good too with
ellen and sharon stone starring and anne heche directing.
but "boys on the side" has to be the greatest movie ever, even if it's
just for introducing me to the amazing indigo girls! thank god i saw
that movie. :-)
happy viewing,
maddie
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 09:59:16 -0700
reply-to: dawn manuel <venussage@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: dawn manuel <venussage@yahoo.com>
subject: re: ig in dallas
mime-version: 1.0
content-type: text/plain; charset=us-ascii
how did you guys get 2nd row tickets??!! i got 4th
date: sun, 21 nov 1999 20:05:01 +0000
from: "l-soft list server at netspace.org (1.8d)" <listserv@netspace.org>
subject: file: "indigo-girls log9910c"
to: underdog@earthlink.net
row on the floor. i bought my tickets they exact
second they went on sale through the bronco bowl.
i am really looking forward to meeting everyone at the
list meet.
this is the most excitement my life has seen in a long
time!
sad, but true.
=====
dawn
"got to learn to respect what we don't understand" amy ray
"what i won't give, to have the things that mean the most, not to mean the things i miss." emily saliers
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 13:05:57 -0400
reply-to: bean@neu.edu
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: elaine bean <bean@neu.edu>
organization: northeastern university, faculty senate office, 442 ry,
360 huntington ave., boston, ma 02115
subject: re: nigc: gay movies
x-to: madonna maynes <m.maynes@student.qut.edu.au>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
no one's mentioned "pricilla, queen of the desert (or maybe someone did
and i jus wasn't paying attention) - it's not a lesbian movie, of
course, but a fun, fun movie. i would call it a gay film because one of
the drag queens does get together with that mechanic. where else can
you hear abba and see such creative uses of glitter?
elaine
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 10:31:36 -0700
reply-to: dawn manuel <venussage@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: dawn manuel <venussage@yahoo.com>
subject: nigc: michelle malone
mime-version: 1.0
content-type: text/plain; charset=us-ascii
does anyone else out there really dig michelle malone?
=====
dawn
"got to learn to respect what we don't understand" amy ray
"what i won't give, to have the things that mean the most, not to mean the things i miss." emily saliers
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 10:41:34 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: need 1 ticket - berkeley 11/7
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hi all,
if anyone happens to have one seat to the 11/7 concert in berkeley for
little ol' me, let me know!
i'll be your best friend... :)
thanks,
jean
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 13:00:27 -0600
reply-to: "sarah t. rosenblum" <strosenblum@students.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "sarah t. rosenblum" <strosenblum@students.wisc.edu>
subject: nigc
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
has anyone heard of a group called the velvet janes?
just curious as to what they're like.
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 14:09:55 -0400
reply-to: michael cunningham <mcunningham@pbp1.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: michael cunningham <mcunningham@pbp1.com>
subject: tour info update (igc!)
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
hkf's,
here's some new tour info that i found:
12/04/99 minneapolis, mn u. of minnesota - northrup auditorium
onsale: 10/23 - 10:00am (651)989-5151 (local tm)
12/07/99 indianapolis, in murat theatre
onsale: 10/30 (317)239-5151 (local tm)
[although these aren't up on tm yet]
plus there's a whole bunch of more phone numbers & links on my site so you
can keep checking on info and keep bugging the box office peoples...
thanks & let us know of any more onsale info!
a+e=ig
mcunningham5@earthlink.net
http://home.earthlink.net/~mcunningham5/indigotour.html
"...what a blessed sky"
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 13:33:28 -0400
reply-to: hicktruckdriver <dcw2428@osfmail.isc.rit.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: hicktruckdriver <dcw2428@osfmail.isc.rit.edu>
subject: re: nigc: michelle malone
x-to: dawn manuel <venussage@yahoo.com>
in-reply-to: <19991021173136.11562.rocketmail@web217.mail.yahoo.com>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
on thu, 21 oct 1999, dawn manuel wrote:
> does anyone else out there really dig michelle malone?
if she were straight, well, wild horses couldn't... ;)
and we have something in common -- she plays hamer guitars. i was
hoping she'd show up at the factory invite/tour/jam last friday, but no
luck.
darius
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 14:22:25 -0400
reply-to: michael cunningham <mcunningham@pbp1.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: michael cunningham <mcunningham@pbp1.com>
subject: ooops - 1 more onsale info.
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
hkf's,
as soon as i hit that dang-um send button, i realize i forgot something that
is onsale as of now!!!
11/18/99 - laramie, wy:
thursday, nov. 18, 8 p.m. -- indigo girls in performance, a&s auditorium.
tickets are available at the wyoming union asuw ticket office at
307-766-3327: $20 (uw students), $22.50 (seniors and children under 18, and
$25 (general public).
go, go, go!!!
a+e=ig
mcunningham5@earthlink.net
http://home.earthlink.net/~mcunningham5/indigotour.html
"...what a blessed sky"
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 11:12:53 -0700
reply-to: amy swenson <aswenson@cthulhu.engr.sgi.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: amy swenson <aswenson@cthulhu.engr.sgi.com>
subject: needing rose polenzani recommendations
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
hello - i'm looking to get my first rose p. cd and i'm looking for
recommendations on where to start - i know she has quite the following
among listees! :) any help would be appreciated!
love,
amy
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 11:18:11 -0700
reply-to: melissa gordon <melissa@ce1.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: melissa gordon <melissa@ce1.com>
organization: creative endeavors
subject: re: nigc: michelle malone
x-to: dawn manuel <venussage@yahoo.com>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
no, no one really cares about michelle malone. just about 90% of the list.
she is wonderful!
melissa
----- original message -----
from: dawn manuel <venussage@yahoo.com>
to: <indigo-girls@netspace.org>
sent: thursday, october 21, 1999 10:31 am
subject: nigc: michelle malone
> does anyone else out there really dig michelle malone?
>
>
> =====
> dawn
>
>
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 11:43:52 -0700
reply-to: dawn manuel <venussage@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: dawn manuel <venussage@yahoo.com>
subject: re: nigc: michelle malone
mime-version: 1.0
content-type: text/plain; charset=us-ascii
would you guys believe i didn't know she was not
straight? i try not to assume, because i hate it when
people assume things about me. no one ever believes
i'm gay.
i once applied as a bartender at a gay bar in denver,
and they said "you do know this is a gay bar, right?"
ugh. so, now i have short hair! :) and, people are
always hitting on my girlfriend when i'm with her!
so, i decided i might want to butch up a tad.
anyway, that's off topic. forgive the rambling!
i am very pleased by the response i got from my fellow
mm lovers. i don't know anyone who likes her outside
of this list. actually, i don't know anyone who has
heard of her outside of this list. that's just
wrong!
--- hicktruckdriver <dcw2428@osfmail.isc.rit.edu>
wrote:
if she were straight, well, wild horsescouldn't... ;)
and we have something in common -- she plays
hamer guitars. i was hoping she'd show up at the
factory invite/tour/jam last friday, but no luck.
>
> darius
=====
dawn
"got to learn to respect what we don't understand" amy ray
"what i won't give, to have the things that mean the most, not to mean the things i miss." emily saliers
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 11:26:48 -0600
reply-to: j61coop@us.ibm.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: val merrill <j61coop@us.ibm.com>
subject: her gift...
mime-version: 1.0
content-type: text/plain; charset=us-ascii
funny how you can hear a song a million times and then, suddenly, one day you
hear a verse as if for the first time, that moves you to tears.
".....oh mercy what i won't give
to have the things that mean the most
not to mean the things i miss...."
ahh emily, i could never adequately thank you for sharing your gift with the
world......
val
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 11:57:31 -0700
reply-to: dawn manuel <venussage@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: dawn manuel <venussage@yahoo.com>
subject: re: her gift...
mime-version: 1.0
content-type: text/plain; charset=us-ascii
val, i could not agree more. that has been one of my
favorite lines for years. that and i find myself
sometimes, in a moment of bliss, singing "feels so
funny to be free!"
=====
dawn
"got to learn to respect what we don't understand" amy ray
"what i won't give, to have the things that mean the most, not to mean the things i miss." emily saliers
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 13:57:23 -0500
reply-to: sheryl jones <sljones1@facstaff.wisc.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: sheryl jones <sljones1@facstaff.wisc.edu>
subject: re: her gift...
in-reply-to: <19991021185731.9038.rocketmail@web222.mail.yahoo.com>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
yes, it's amazing that emily wrote those lines. don't forget to praise
amy, though, for the way they are sung.
----------------------------------------------------------
sheryl jones
sljones1@facstaff.wisc.edu
cooper seay page: http://www.geocities.com/felidae/cooper/cooper.htm
bootleg page: http://www.geocities.com/felidae/boots.htm
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 15:03:51 edt
reply-to: mariedemi@cs.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: marie demiguel <mariedemi@cs.com>
subject: still have one extra ticket for 10/22 athens, ga show!
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
i will be leaving soon. if you know anyone that will like to go to the show
(last minute)
please have them call me on my cell phone (954-) 559-3633. it is a great seat
on main floor! section iii row 1.
me and my friends are driving from south florida to georgia, then to orlando
for another show at the hard rock.
this is going to be a great weekend!
please call me if you know anyone who is interested in the ticket, i will
take whatever for gas money.
thanks!
peace, love and the ig!
marie
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 12:06:37 -0700
reply-to: dawn manuel <venussage@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: dawn manuel <venussage@yahoo.com>
subject: re: her gift...
mime-version: 1.0
content-type: text/plain; charset=us-ascii
i run into the quotiing problem often. i can't decide
whether to quote the singer, or the writer. please
accept this preemptive apology for future misquotes!
--- sheryl jones <sljones1@facstaff.wisc.edu> wrote:
> yes, it's amazing that emily wrote those lines.
> don't forget to praise
> amy, though, for the way they are sung.
>
-------------------------------------------------------
=====
dawn
"got to learn to respect what we don't understand" amy ray
"what i won't give, to have the things that mean the most, not to mean the things i miss." emily saliers
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 15:07:33 -0400
reply-to: nancy lambert <nlambert@inter-science.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: nancy lambert <nlambert@inter-science.com>
subject: orlando listmeet
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
alright i am stepping forward now and taking the bull --er cow-- by the
horns -- er -- ears. well whatever. my gf and i are going to the show. i
have heard from a few random people that will be going also so -- i will
organize a listmeet in orlando. i live in tampa but we will be staying at a
hostel or campground in kissimmee. all those interested please e-mail me
privately and i will come up with a location for breakfast or lunch.
breakfast for those that want to stake out the hr for a bus, lunch for those
just wanting to get there early. i am gen. admis. so i plan on getting
there early. not too early tho, since my gf is not as big an ig freak as i
am and this is her birthday present and all. anywho for those familiar
with orlando i was thinking maybe a restaurant in crossroads near disney's
lake buena vista. it's easy to find (you can see it from i-4) and it's
pretty well centrally located.
let me know,
nancy
support ride 4 chiapas!!!!
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 15:40:54 edt
reply-to: lindystar2@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lindystar2@aol.com
subject: re: her gift...
x-to: j61coop@us.ibm.com
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 10/21/99 1:47:54 pm est, j61coop@us.ibm.com writes:
oh! i love that line sooo much!. that was one of the first ig songs i ever
heard, and i fell in love with it from the start, i played it all the time=)
i get goosebumps just thinking about it=)
casey
<< ".....oh mercy what i won't give
to have the things that mean the most
not to mean the things i miss...." >>
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 16:02:44 edt
reply-to: wishmonstr@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "e. moranian bolles" <wishmonstr@aol.com>
subject: re: stomp & stammer; cons review -- a bit of a political rant
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
melissa@ce1.com posted:
<< so the message must be that capital punishment = evil, a view which is
backed up by the girls' listing of the national coalition to abolish the
death penalty in the "resources" section of the album's liner notes. but do
you think ray would ever sing some weepy song mourning the execution of a guy
who raped and dismembered little girls, or dragged some black man behind his
pickup truck until he was decapitated? hell, no! to do so would cause ray's
listeners to question their blanket acceptance of the indigo girls'
anti-capital punishment stance. such horrendous murders do not lend
themselves so easily to emotional pleas for leniency and calls for re-hab
hand-holding. was not tucker also "being cruel" when she committed murder in
the first place? such self-evident details, when pointed out, crumble the
effectiveness of protest songs such as "faye tucker," exposing them to be
all-too-shallow. it's a consistent failing that the indigo girls would do
well to overcome. >>
ummmm, no.
pardon me, but his argument is based solely on the theory there is nothing
wrong with the death penalty. anyone is more likely to create art about a
case that raises questions throughout society and gets a ton of media
coverage than about a case that barely gets time in the press and raises few
if any new points. the whole point was just because she was "reborn", this
woman thought she could get away with murder... and people were willing to
let her! thus, "whatever it was you thought might occur, they've got
something else on their minds..." i can't find a place in the song where amy
justifies or excuses what tucker did (ie, murder). she even says, "killing
don't pay!" the whole point of being anti-death penalty is that *killing is
wrong*. in the song, amy isn't saying she wants the woman released. . . she
doesn't even totally say she shouldn't be killed only because of her new
religous convictions ("well you may be reborn but it's all just for scorn,
and that's what you'll take to your grave" is a little vague).
the fact is, tucker's execution raised questions nationally about what the
death penalty is supposed to accomplish. it's basically a guaranteed way to
rid society of monsters, but if they're no longer monsters... ? frankly, on
a number of levels, tucker's case gave us an out -- a chance to "prove"
ourselves through mercy. but "nothing could move us to rise above just being
cruel..."
honestly, i can't understand how a person can reconcile being anti-death
penalty and being able to justify abortion (in times of non-medical
necessity). (while i am pro-choice, i'm personally anti-abortion and would
never have an abortion myself.) and so (i'm just asking for flames, aren't
i?) while i think his argument about this specific song is silly and
illogical, i also think the reviewer has a point in terms of leftist politics
in general -- there is often a sort of shallow failing when it comes to the
heart of different matters. however, this is definitely also true of the
right-wing. for example, how can you defend the right to bear arms but also
support a flag burning amendment to the constitution? the right to bear arms
is all about protecting oneself against the government, being able to rise up
against the government, etc. flag burning is a way (albeit uncreative) to
speak out against the government. it's all the same!
=d
~ elizabeth
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 16:22:38 -0400
reply-to: heather rosenberg <heather@rosenbergcpa.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: heather rosenberg <heather@rosenbergcpa.com>
subject: ig at uga
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
i was wondering if anyone knows if you need a student i.d. to get in the
show if you have a student ticket. seeing as i have a student ticket and no
i.d. i would need to be hussling my butt around to find me some id's. if
anyone knows please let me know privately.
thanks,
heather
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 13:11:43 pdt
reply-to: bancu rugbygrrl <ravishingruggrbc@hotmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: bancu rugbygrrl <ravishingruggrbc@hotmail.com>
subject: re: indigohio
mime-version: 1.0
content-type: text/plain; format=flowed
hey ya'll,
>12/11 columbus ohio memorial auditorium (vets)
>12/13 dayton ohio memorial auditorium
anyone out there know the number to ticketmaster for ohio?...or the number
to the columbus venue?...i missed the girls when they were here in philly
but my sweetie lives in cincy and we're so psyched to know we've got another
chance at columbus!yeeehaaaa!
thanks!
rugbygrrl
______________________________________________________
get your private, free email at http://www.hotmail.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 16:14:37 -0400
reply-to: nancy lambert <nlambert@inter-science.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: nancy lambert <nlambert@inter-science.com>
subject: re: stomp & stammer; cons review -- a bit of a political rant
x-to: "wishmonstr@aol.com" <wishmonstr@aol.com>
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
i think their stance is more on the justice system. i would condone the
death penalty if the courts weren't so damned racist, bigoted, etc. the
fact is that the justice system in this country will never see 100% accuracy
in conviction -- meaning that who they convict is without a doubt guilty.
and until there is 100% accuracy -- which the last time i checked the only
place that has 100% accuracy is karma/heaven/whatever you want to call it --
i will never condone the death penalty. how do you know for certain that
the person you're killing really did the crime?
just my $.02
nan
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 14:49:32 -0600
reply-to: j61coop@us.ibm.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: val merrill <j61coop@us.ibm.com>
subject: re: nigc: gay movies
mime-version: 1.0
content-type: text/plain; charset=us-ascii
>elaine bean <bean@neu.edu> wrote:
>where else can you hear abba and see such creative uses of glitter?
muriel's wedding
:)
val
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 13:55:55 -0700
reply-to: larissa brown <larissa.brown@eng.sun.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: larissa brown <larissa.brown@eng.sun.com>
subject: re: nigc: gay movies
mime-version: 1.0
content-type: text/plain; charset=us-ascii
and i had mixed feelings about priscilla. i mean, i loved the drag and glitter,
but felt th portrayal of the women in the film was rather odd and in the case of
the one asian woman in the film, actually quite offensive (ping pong ball scene)
why6 does a film which seeks to liberate some people need to oppress othwrs?
it did, though, have the wonderful butterfly man on top of the bus scene.
just my ideas,
larissa
>x-lotus-fromdomain: ibmus
>mime-version: 1.0
>content-disposition: inline
>approved-by: j61coop@us.ibm.com
>date: thu, 21 oct 1999 14:49:32 -0600
>from: val merrill <j61coop@us.ibm.com>
>subject: re: nigc: gay movies
>to: indigo-girls@netspace.org
>
>>elaine bean <bean@neu.edu> wrote:
>>where else can you hear abba and see such creative uses of glitter?
>
>muriel's wedding
>
>:)
>val
>
>--
>please do not send long non-indigo girls-related forwards to the list.
>indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
larissa c. brown
solaris programs project coordinator
larissa.brown@eng.sun.com
650-786-3724 (x83724)
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 16:08:17 -0500
reply-to: barbara bordner <barbinmn@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: barbara bordner <barbinmn@webtv.net>
subject: re: her gift...
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
what song is this from?
<<what i won't give to have the things that mean the most, not to mean
the things i miss?>>
is that from philosophy of loss?
peace
barb
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 17:05:34 -0400
reply-to: hicktruckdriver <dcw2428@osfmail.isc.rit.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: hicktruckdriver <dcw2428@osfmail.isc.rit.edu>
subject: re: stomp & stammer; cons review -- a bit of a political rant
x-to: "e. moranian bolles" <wishmonstr@aol.com>
in-reply-to: <0.d1d1b285.2540cb64@aol.com>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
on thu, 21 oct 1999, e. moranian bolles wrote:
> honestly, i can't understand how a person can reconcile being anti-death
> penalty and being able to justify abortion (in times of non-medical
> necessity).
dangerous turf...
> for example, how can you defend the right to bear arms but also support
> a flag burning amendment to the constitution?
hush now. nobody's supposed to think like that. you vote for the
elephant or the donkey, dammit!
darius
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 17:31:12 -0400
reply-to: susan brill <susan.brill@yale.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: susan brill <susan.brill@yale.edu>
subject: re: her gift...
in-reply-to: <379-380f80c1-2889@storefull-291.iap.bryant.webtv.net>
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
>what song is this from?
>
><<what i won't give to have the things that mean the most, not to mean
>the things i miss?>>
>
>is that from philosophy of loss?
no - it's from language or the kiss. wow - now i want to go listen to that...
-s.
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 14:23:59 -0700
reply-to: beccie lyon <dovesland@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: beccie lyon <dovesland@yahoo.com>
subject: re: stomp & stammer; cons review -- a bit of a political rant
mime-version: 1.0
content-type: text/plain; charset=us-ascii
hey hey hey now......
the thing about being anti death penalty is the whole two wrongs
do not make a right theory....now yes some people do some
horendous things and deserve to be punished, but what do they
truely learn by being killed as their punishment? isnt that the
entire idea behind punishment....that you learn something from
it and come away a better person...and that you learn not to do
it again? what is learned in the grave? personally i think the
whole prison system should be revamped to make the time these
people spend in jail a productive time. let them work and toil
and give back to society....let them learn that leason, not just
kill them, end their life and get them out of our hair...yes i
agree that people like jeffory dahmer and such have no hope of
ever leading productive lives...but what leason will they learn?
i know i know repeatative. but i am slightly out of
practice...sorry....also, the pro choice thing is just that. pro
choice. you choose what you want to do with your body...and if
you choose to not have an abortion...then that is your
choice!!!!....the realities of that are scary....i want to have
that choice...but of course only sleeping with women kinda slims
my chances for pregnancy down a bit, but if something
happened...god forbid i get raped...and i am pregnant...then i
have to make that decision, and it is my body and i should have
the right to choose what to do...ok nuff said....i will climb
back down off my soapbox and await the flames...
=====
peace, love & indigo light
beccie lyon
may the path that you are on take you above
your expectations for the road ahead
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 14:32:57 -0700
reply-to: dawn manuel <venussage@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: dawn manuel <venussage@yahoo.com>
subject: makin' copies....
mime-version: 1.0
content-type: text/plain; charset=us-ascii
okay, so i was just making copies (part of my
glamorous job), and came across an applicatiton with
the name "ozzie" on it. now, i seem to have
"ozziline" stuck in my head, and it won't go away! i
just wanted to share. these things happen to me
constantly. at least i know some of the words! (i
know, i should know them all by heart already, but i
don't!)
just wanted to share an ig moment with my listee
friends!
=====
dawn
"got to learn to respect what we don't understand" amy ray
"what i won't give, to have the things that mean the most, not to mean the things i miss." emily saliers
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 17:39:21 edt
reply-to: dschulman@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "d. schulman" <dschulman@aol.com>
subject: enough gay films already
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 10/21/99 2:56:51 am, someone wrote:
<<<<and in response to moving this to email, i am thoroughly enjoying this
thread, not to mention adding some movies to my list of things to see.>>>>
it has been our policy that when the list starts getting requests to take it
private, that's what we do (not to mention the 48 hour nigc rule). there are
a great many lurkers here who don't necessarily enjoy all the nigc. another
list was created in response to complaints about nigc... you can take this
discussion there if that's what you want. tigger? where are you? share
that info please.
dee
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 17:42:38 edt
reply-to: erinsuepoo@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "<erin carroll>" <erinsuepoo@aol.com>
subject: re: age poll update
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
in a message dated 10/21/99 10:40:17 am eastern daylight time,
someone...writes:
<< what you asked for wasnt offensive, but it wasnt accurate either.
still isnt. asking for sex isnt really asking the right
question, imo. my sex isnt my gender, and my gender is what
people "read" when they see me. >>
ok, i give up...just tell me what you want to tell me and that way, i will
not be offensive, inaccurate or just plain wrong anymore...
we are conducting a poll...for entertainment. not publishing a book...or a
dictionary...or anything serious at all for that matter. i don't really
think anyone cares if there is an incorrect word used (or something
tragically mis-spelled in their email) you can't please anyone...may as well
just please yourself.
and a sincere thank you to all that have been so kind...and didn't find it
necessary to correct me...
erin sue
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: fri, 22 oct 1999 09:46:42 +1200
reply-to: emiray saliamy <ig_boogy_babe@chickmail.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: emiray saliamy <ig_boogy_babe@chickmail.com>
organization: chickmail (http://www.chickmail.com:80)
subject: billboard - cons 74th..... errkk
mime-version: 1.0
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 14:52:34 -0700
reply-to: jean moses <sneakyjean@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: jean moses <sneakyjean@yahoo.com>
subject: ig on radio alice!
mime-version: 1.0
content-type: text/plain; charset=us-ascii
woohoo! they're playing "peace tonight" on alice in san francisco.
it's the first time i have heard anything from the new album on the
radio.
little things make my day :)
jean
=====
jean moses
sneakyjean@yahoo.com
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 15:02:55 -0700
reply-to: joan morrison <morrison_joan@yahoo.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: joan morrison <morrison_joan@yahoo.com>
subject: re: age poll update
mime-version: 1.0
content-type: text/plain; charset=us-ascii
asking for sex isnt really asking the
> right
> question, imo. my sex isnt my gender, and my gender
> is what
> people "read" when they see me. >>
oh for god's sake people. are you male or female or
other??? geez.
peace!
=====
joan :-d
visit my home page:
http://www.hometown.aol.com/joanm12345/index.html
__________________________________________________
do you yahoo!?
bid and sell for free at http://auctions.yahoo.com
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 15:08:08 -0700
reply-to: "amy j. putnam" <pegasus@crl.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "amy j. putnam" <pegasus@crl.com>
subject: re: age poll update
x-to: joan morrison <morrison_joan@yahoo.com>
in-reply-to: <19991021220255.29473.rocketmail@web110.yahoomail.com>
mime-version: 1.0
content-type: text/plain; charset=us-ascii
ok, since this was my private post to erin which was posted to
the list, i will asnwer here.
the idea behind asking for gender and not for sex is that
sex is defined in two ways. gender is a fluid continuum
that allows people who see themselves (myself included)
as not specifically male/man or female/woman with al off
the societal baggage that is attached to find other ways,
other words within our limited language, to find/express/
define our gender expressions.
so, if you want to keep putting limits on it, yeah, i am
"other". if you really are interseted in some understanding
how gender is more expansive than sex, how language is able
to, in limited ways, expand our self-definitions, i would
recommend kate bornstein's book "gender outlaw: on men, women,
and the rest of us". or myself, i talk about it on my web
page.
yours, from an "other" perspective.
on thu, 21 oct 1999, joan morrison wrote:
>
> oh for god's sake people. are you male or female or
> other??? geez.
>
_________
amy p. \ / who holds your hand
pegasus@crl.com \ / when you're alone
monk@world.std.com \ /
the original photo monk \ / --patty larkin
http://www.crl.com/~pegasus
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 10:13:04 -0700
reply-to: "lee, jenny" <jenlee@unex.ucla.edu>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: "lee, jenny" <jenlee@unex.ucla.edu>
subject: concert in los angeles
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
greetings all!
found this on a search engine, not sure if this will work but it's worth a
try!
i have one ticket for thursday, nov. 4th concert at the wiltern theatre.
i purchased 2 tickets and realized that i should have just purchased one,
the seat is in the last row of the orchestra section. i don't have the
'exact seat number' with me at the moment.
if you're interested please e-mail me back!
thanks,
jenny
totoro930@aol.com
jenlee@unex.ucla.edu
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 14:03:36 -0400
reply-to: lori and gavin macleod <macleods@spectranet.ca>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lori and gavin macleod <macleods@spectranet.ca>
subject: taped the view?
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
hi everyone
i'm no longer on the list, since the birth of my son (too much time required
to take care of a 3 month old!!). but i'm wondering if there's someone here
that can help. i taped rosie but missed the view. i have tons of video to
trade, but nothing recent like austin city limits, vh1 stuff etc. i'm
asking if someone would trade the view with some other stuff to make a
fuller video trade. i have the ppv and lots of other clips and concerts.
thanks
lori
macleods@spectranet.ca
{gav/lor icq#8264425}
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 18:27:25 edt
reply-to: vickistein@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: vicki stein <vickistein@aol.com>
subject: fwd: age poll update
mime-version: 1.0
content-type: multipart/mixed; boundary="part1_0.3565cc9f.2540ed4d_boundary"
--part1_0.3565cc9f.2540ed4d_boundary
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
--part1_0.3565cc9f.2540ed4d_boundary
content-type: message/rfc822
content-disposition: inline
return-path: vickistein@aol.com
from: vickistein@aol.com
full-name: vickistein
message-id: <0.c0537689.2540ec0e@aol.com>
date: thu, 21 oct 1999 18:22:06 edt
subject: re: age poll update
to: morrison_joan@yahoo.com
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
x-mailer: windows aol sub 41
perhaps this will settle the discourse? and i quote the dictionary:
sex [1] (noun)
[middle english, from latin sexus]
first appeared 14th century
1 : either of the two major forms of individuals that occur in many species
and that are distinguished respectively as female or male
2 : the sum of the structural, functional, and behavioral characteristics of
living things that are involved in reproduction by two interacting parents
and that distinguish males and females
3 a : sexually motivated phenomena or behavior
b : sexual intercourse
4 : genitalia
now, i am almost 100% certain that the issue in question relates to item no.
1 listed above. it is what it is, we are what we are. i think it's great
erin sue is putting the effort into this poll...so, here, this is me:
age: 39
sex: f
sexual orientation: heterosexual.
peace, love, and understanding to all ~
vicki
--part1_0.3565cc9f.2540ed4d_boundary--
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 19:17:24 edt
reply-to: lisa071573@aol.com
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: lisa r <lisa071573@aol.com>
subject: some igc, michelle, rose, melissa, ranting
mime-version: 1.0
content-type: text/plain; charset="us-ascii"
content-transfer-encoding: 7bit
ok i thought it was definitely "modern scribes write, 'in jesus christ,
everyone is free.' " thanks to the people who answered my questions about
melissa's breakdown - i haven't had a chance to watch the cd-rom bit so i
guess i'll be doing that...my take on lyrics is that if you write them, make
a cd, and want people to listen to your music - don't you want them to know
what the hell you're saying? just my opinion...yes, i love michelle malone
too...not a big fan of her earlier stuff but devil moon and homegrown are
both great :) as for rose, i think i like dragersville better than anybody -
but i do think rose is ten times better live...i saw her in berkeley in
someone's living room and it was so cool. since i'm doing recommendations
again, please please please check out barbara kessler - she's very
underappreciated but she's wonderful!
back to ig and the death penalty....this is one of those issues i'm having
problems with...i don't think we should have one if we're going to use it the
way we do. i think it's not a very discriminating (or maybe it is - in
another sense) policy. i think people who are really innocent or people who
commit not as terrible stuff (flame on...) don't deserve to die...i remember
watching a thing on one of those damn dateline primetime shows about some
black man who was on death row for killing one person years and years
ago...and now he was sorry and old and was a productive member of prison
society...people like jeffery dahmer, charles manson - people who clearly
cannot and will not be reformed are the ones who should be getting the death
penalty. however, since more people then serial murderers/rapists/child
killers are being put to death - or people like mumia who (and i don't know
shit about this so don't bite my head off...) it seems has not gotten due
process and may be inncoent....i know my grammar here sucks and you can flame
me for that too - it's just - ironic - you have to sidestep around issues
such as this (and choose your words carefully) because, like someone else
said, you gotta vote for the donkey or the elephant...well i want to be
pro-choice and anti-death penalty - not because i don't think assholes like
manson shouldn't fry, but because the system such as it is is flawed...i
don't like either party...anyway, sorry for my soapbox...but i think amy is
coming down on both things - faye who killed and those who want her to
fry...that's why killing don't pay...
my too sense
lisa
"walking on eggshells, afraid of what i'll say. well, i have to be careful,
or you might run away..." barbara kessler
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 19:30:01 -0400
reply-to: carrie knepp <indigo4me@webtv.net>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: carrie knepp <indigo4me@webtv.net>
subject: re: michelle malone
content-type: text/plain; charset=us-ascii
content-transfer-encoding: 7bit
mime-version: 1.0 (webtv)
i fell in love with michelle when i saw her in atlanta in 1997, she made
a special appearance at a girls show. i also was able to see her open
for the girls in 1998. we had a few remarks for each other. all i can
say is that southern hospitality will win me over every time.
lovin the girls 4-ever,
carrie
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 21:24:53 +0000
reply-to: kz123@att.net
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: kristen curry <kz123@att.net>
subject: re: her gift...
x-to: barbara bordner <barbinmn@webtv.net>
"the language or the kiss". the 1200 curfews version is
unreal when amy comes in with that line. could tear your
heart out.
kc
> what song is this from?
>
> <<what i won't give to have the things that mean the most, not to mean
> the things i miss?>>
>
> is that from philosophy of loss?
>
> peace
>
> barb
>
> --
> please do not send long non-indigo girls-related forwards to the list.
> indigo girls faq and indigo girls mailing list faq:
> http://www.fl.net.au/~sherlyn/ig
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
=========================================================================
date: thu, 21 oct 1999 17:20:29 -0400
reply-to: catherine spinale <catherine.spinale@pmn.com>
sender: indigo girls mailing list <indigo-girls@netspace.org>
from: catherine spinale <catherine.spinale@pmn.com>
subject: re: her gift
mime-version: 1.0
content-type: text/plain; charset="iso-8859-1"
content-transfer-encoding: 7bit
i totally agree with you val. that line in lotk
has always stuck in my head. one of my favorite's
is the line in the wood song - "sometimes i ask
to sneak a closer look, skip to the final chapter
of the book". i can't tell you how many times
that song has helped me when i was confused or
down or just needed a friend.
no, i can't forget amy - i like "the higher the
leap the harder the ground" - isn't that the truth -
and she has so many others, i just think right
now - it's after 5 and my brain is not functioning
properly right now.
bye for now
--
please do not send long non-indigo girls-related forwards to the list.
indigo girls faq and indigo girls mailing list faq:
http://www.fl.net.au/~sherlyn/ig
home | appearances | articles | bootlegs | discography | fanzine | faq | fun | highlights | listlogs | official | socs | songs | videos | youtube